BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0905 (776 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y12322-1|CAA72991.1| 1191|Drosophila melanogaster u-shaped protein. 29 9.4 BT015278-1|AAT94507.1| 1191|Drosophila melanogaster LD12631p pro... 29 9.4 AE014134-116|AAF51488.2| 1191|Drosophila melanogaster CG2762-PA ... 29 9.4 >Y12322-1|CAA72991.1| 1191|Drosophila melanogaster u-shaped protein. Length = 1191 Score = 28.7 bits (61), Expect = 9.4 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 3/75 (4%) Frame = -2 Query: 520 QLVPQFGQHATPDDQPPRGTPTSKHAFCGVIRAARVIFNGLIVVSRLL---IKHICFFSG 350 QL+P+ Q ATP + P +P + C + +V N L+ L K + Sbjct: 121 QLIPKLEQPATPPSE-PEASPCPSPSPCPTPKYPKVRLNALLASDPALKPDAKELTLPDS 179 Query: 349 GQLSDPPTLFPEATA 305 L+ PP + P+ A Sbjct: 180 RLLAPPPLVKPDTQA 194 >BT015278-1|AAT94507.1| 1191|Drosophila melanogaster LD12631p protein. Length = 1191 Score = 28.7 bits (61), Expect = 9.4 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 3/75 (4%) Frame = -2 Query: 520 QLVPQFGQHATPDDQPPRGTPTSKHAFCGVIRAARVIFNGLIVVSRLL---IKHICFFSG 350 QL+P+ Q ATP + P +P + C + +V N L+ L K + Sbjct: 121 QLIPKLEQPATPPSE-PEASPCPSPSPCPTPKYPKVRLNALLASDPALKPDAKELTLPDS 179 Query: 349 GQLSDPPTLFPEATA 305 L+ PP + P+ A Sbjct: 180 RLLAPPPLVKPDTQA 194 >AE014134-116|AAF51488.2| 1191|Drosophila melanogaster CG2762-PA protein. Length = 1191 Score = 28.7 bits (61), Expect = 9.4 Identities = 20/75 (26%), Positives = 32/75 (42%), Gaps = 3/75 (4%) Frame = -2 Query: 520 QLVPQFGQHATPDDQPPRGTPTSKHAFCGVIRAARVIFNGLIVVSRLL---IKHICFFSG 350 QL+P+ Q ATP + P +P + C + +V N L+ L K + Sbjct: 121 QLIPKLEQPATPPSE-PEASPCPSPSPCPTPKYPKVRLNALLASDPALKPDAKELTLPDS 179 Query: 349 GQLSDPPTLFPEATA 305 L+ PP + P+ A Sbjct: 180 RLLAPPPLVKPDTQA 194 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,760,155 Number of Sequences: 53049 Number of extensions: 645951 Number of successful extensions: 1786 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1786 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3602427675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -