BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0904 (359 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g27810.2 68415.m03372 xanthine/uracil permease family protein... 26 8.7 At2g27810.1 68415.m03371 xanthine/uracil permease family protein... 26 8.7 >At2g27810.2 68415.m03372 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 660 Score = 25.8 bits (54), Expect = 8.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -1 Query: 260 HWGGKRGGAFKRPGELVPALGGSMTELPNTVAF*IF 153 H+ G P +VPA+GGS E+ N V+ +F Sbjct: 189 HYLSMLGSLILVPLVIVPAMGGSHEEVANVVSTVLF 224 >At2g27810.1 68415.m03371 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 709 Score = 25.8 bits (54), Expect = 8.7 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -1 Query: 260 HWGGKRGGAFKRPGELVPALGGSMTELPNTVAF*IF 153 H+ G P +VPA+GGS E+ N V+ +F Sbjct: 189 HYLSMLGSLILVPLVIVPAMGGSHEEVANVVSTVLF 224 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,602,558 Number of Sequences: 28952 Number of extensions: 71124 Number of successful extensions: 114 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 469342752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -