BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0900 (716 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0442 - 3369827-3370168,3370608-3372616,3372953-3373277,337... 29 3.7 12_01_0268 - 1941515-1941534,1941868-1942057,1942155-1942322,194... 28 6.4 >11_01_0442 - 3369827-3370168,3370608-3372616,3372953-3373277, 3373386-3373415 Length = 901 Score = 29.1 bits (62), Expect = 3.7 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 2/73 (2%) Frame = +3 Query: 210 RLEGLRIVPDQRPVLCSKGASPGKDCNVKCSDLLTDDITKAAKCAKKIYKRHRFDAWY-- 383 R EG P ++P+ GASP + K +TD+ T+ AK + ++ + Sbjct: 2 REEGGIASPGEKPI--PNGASPNHSQSPKICSRITDNETQGTATAKSLNEKLVLETVSDD 59 Query: 384 GWKNHCQGSLPDI 422 HCQ PD+ Sbjct: 60 SSTQHCQSPQPDV 72 >12_01_0268 - 1941515-1941534,1941868-1942057,1942155-1942322, 1943425-1943568,1944284-1944443,1944512-1944621, 1944900-1945019,1945649-1945766,1946610-1946729, 1947228-1947285,1947590-1947723,1949332-1949414, 1949544-1949786,1949851-1949976,1950075-1951562 Length = 1093 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 608 YVIENVKKLALSTQIAYSNLARNR-FDKNLGLSFN 709 YV++N K L + +++L NR FD+ L +S N Sbjct: 675 YVLDNCKLSFLLVMLVFASLVGNRYFDRELAMSIN 709 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,811,076 Number of Sequences: 37544 Number of extensions: 316481 Number of successful extensions: 758 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 758 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -