BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0900 (716 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g45530.1 68415.m05662 zinc finger (C3HC4-type RING finger) fa... 29 3.1 At4g37360.1 68417.m05291 cytochrome P450 family protein cytochro... 29 4.1 At4g33985.1 68417.m04822 expressed protein 29 4.1 At3g13590.1 68416.m01711 DC1 domain-containing protein contains ... 29 4.1 At3g51310.1 68416.m05616 vacuolar protein sorting-associated pro... 28 7.1 At1g11925.1 68414.m01377 stigma-specific Stig1 family protein co... 28 7.1 At4g28550.1 68417.m04084 RabGAP/TBC domain-containing protein si... 27 9.4 At3g55980.1 68416.m06220 zinc finger (CCCH-type) family protein ... 27 9.4 >At2g45530.1 68415.m05662 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 240 Score = 29.1 bits (62), Expect = 3.1 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 4/62 (6%) Frame = +3 Query: 231 VPDQRPVLCSKGASPGKDCNVKCSDLLTDDITKAAKCAKKIYKRHR--FDAWYGWK--NH 398 +P ++ V S+ S + C V D I +C + K HR DAW+ K N Sbjct: 56 IPPEKEVSLSRNGSSHEQCRVCLQDKEEVLIELGCQCRGGLAKAHRSCIDAWFRTKGSNQ 115 Query: 399 CQ 404 C+ Sbjct: 116 CE 117 >At4g37360.1 68417.m05291 cytochrome P450 family protein cytochrome P450 monooxygenase, Arabidopsis thaliana, PID:d1029478 Length = 499 Score = 28.7 bits (61), Expect = 4.1 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 4/68 (5%) Frame = -1 Query: 392 LPTVPGIEAVTFVNFLSAFRCLSNVVSQE--VGALNV--AVFAWTGAFAAQYRSLIWNNP 225 LP + I + T + +A L +V S++ VG ++ T A+A L+W++P Sbjct: 348 LPYLQNIVSETLRLYPAAPMLLPHVASKDCKVGGYDMPRGTMLLTNAWAIHRDPLLWDDP 407 Query: 224 *SFEPLRF 201 SF+P RF Sbjct: 408 TSFKPERF 415 >At4g33985.1 68417.m04822 expressed protein Length = 154 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 84 HEMRSRA*AEETWLRRKSHEELGMSGRAR 170 H A EE WLR+K + LG GR++ Sbjct: 19 HSWSPDADREEAWLRKKGKQSLGRLGRSK 47 >At3g13590.1 68416.m01711 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 513 Score = 28.7 bits (61), Expect = 4.1 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = -1 Query: 161 TRHTQFLMRFSSKPCFLS---SCTRPHLVNVLASEPTQRTTKAKIINFCISIVSFE 3 TR+ L + SSK S S HLVNV E + R ++ I C S VSFE Sbjct: 6 TRNMMTLSKRSSKTKTGSVWFSYLEEHLVNVHIFEESPRDSRDAICKLCKSTVSFE 61 >At3g51310.1 68416.m05616 vacuolar protein sorting-associated protein 35 family protein / VPS35 family protein similar to vacuolar protein sorting 35 [Mus musculus] GI:11875394; contains Pfam profile PF03635: Vacuolar protein sorting-associated protein 35 Length = 783 Score = 27.9 bits (59), Expect = 7.1 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = -2 Query: 553 GRCSNYIQISLNFYLKTRTKHTGLFRGDRIESLAEVHSGI*QLLISGKEPW 401 G S Y+++ LN YL K GD I+SLAE+ + + SG EP+ Sbjct: 702 GSVSLYVEL-LNKYLYFLEKGNQQVTGDTIKSLAELIKSETKKVESGAEPF 751 >At1g11925.1 68414.m01377 stigma-specific Stig1 family protein contains Pfam profile PF04885: Stigma-specific protein, Stig1 Length = 121 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 219 GLRIVPDQRPVLCSKGASPGKD-CNVKCSDLLTDDITKAAKCAK 347 G + D+ +C SPG++ C KC DL T+ + +C K Sbjct: 44 GATLTCDKSSKVCRLKGSPGRNCCRKKCVDLRTNKL-NCGRCGK 86 >At4g28550.1 68417.m04084 RabGAP/TBC domain-containing protein similar to SP|P09379 GTPase-activating protein GYP7 (Fragment) {Yarrowia lipolytica}; contains Pfam profile PF00566: TBC domain Length = 424 Score = 27.5 bits (58), Expect = 9.4 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 Query: 357 KRHRFDAWYGWKNHCQGSLPDISS 428 + HR + +Y WK C+ +P + S Sbjct: 100 RNHRREQYYAWKEECKNMVPLVGS 123 >At3g55980.1 68416.m06220 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) and Pfam domain, PF00023: Ankyrin repeat Length = 580 Score = 27.5 bits (58), Expect = 9.4 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = -2 Query: 319 SSVRRSEHLTLQSLPGLAPLLHSTG 245 S+V +S +L+ +PGL+PL +S+G Sbjct: 321 SAVAQSPFSSLEMMPGLSPLAYSSG 345 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,565,320 Number of Sequences: 28952 Number of extensions: 251444 Number of successful extensions: 635 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1555552968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -