BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0896 (657 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 24 1.1 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 24 1.5 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 23 3.4 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 5.9 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 5.9 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 7.8 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 24.2 bits (50), Expect = 1.1 Identities = 17/58 (29%), Positives = 23/58 (39%) Frame = +3 Query: 426 SAKNQNLAIAYRASNLHIPSVAAPGPXWHPPHLKDP*RVPRQNHEHILSSPLGQSIRH 599 ++ + +L+ A S H P V + PP P Q H H SSP Q H Sbjct: 284 ASHHSHLSSALGRSACHSPGVYPSTAGFLPPSYHPHQHHPSQYHPHRGSSPHHQHGNH 341 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.8 bits (49), Expect = 1.5 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +2 Query: 404 VDSVLDVVRKESESCDCLQG 463 +DS+++++R ++CD L G Sbjct: 106 IDSIINIIRVRVDACDRLWG 125 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -3 Query: 250 GTYLXAGGFIVVY 212 GT+L +GGF +VY Sbjct: 70 GTFLGSGGFGIVY 82 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 249 PRPFSSTWSPAPWTLSA 299 P F S W P P+ L+A Sbjct: 65 PEFFDSLWQPDPYFLNA 81 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 206 CAPTASQSPHGRHRWGRCRARQ 141 C+P Q+P R GR R R+ Sbjct: 392 CSPPPRQTPPSRKESGRRRRRR 413 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/44 (27%), Positives = 18/44 (40%) Frame = +3 Query: 495 PGPXWHPPHLKDP*RVPRQNHEHILSSPLGQSIRHCRRTIQMRL 626 P P PP P P QN ++ SP I ++ +Q + Sbjct: 40 PNPSQGPPPGGPPGAPPSQNPSQMMISP-ASGIHQMQQLLQQHI 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,355 Number of Sequences: 438 Number of extensions: 4077 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -