BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0895 (618 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1281.01 |ags1|mok1, SPCC338.01c, SPCC17A7.01|alpha-1,4-gluca... 27 2.2 SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|c... 25 6.6 >SPCC1281.01 |ags1|mok1, SPCC338.01c, SPCC17A7.01|alpha-1,4-glucan synthase Ags1|Schizosaccharomyces pombe|chr 3|||Manual Length = 2410 Score = 27.1 bits (57), Expect = 2.2 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 258 YLSLLSRKYLSFKCVFSVVENVALSSMSGK 169 Y SLL RK + + C+ ++N LSS++G+ Sbjct: 2189 YKSLLRRKLVVWFCISVFLQNFWLSSLNGR 2218 >SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|chr 2|||Manual Length = 807 Score = 25.4 bits (53), Expect = 6.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 Query: 214 FLCCRERCSLLYVWQV 167 FLCC LLY+W + Sbjct: 551 FLCCIVSTGLLYIWNI 566 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,410,695 Number of Sequences: 5004 Number of extensions: 47148 Number of successful extensions: 133 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 133 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 271646730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -