BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0895 (618 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 25 2.0 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 23 7.9 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 23 7.9 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 23 7.9 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 25.0 bits (52), Expect = 2.0 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = +1 Query: 307 VEPEISLNKVGHALHLLHPIFXCYTYSERVKSICKELGFIEPAVVQSMYIFKNP 468 VEPE+ +HP + E+ K++ GF+ +YIF NP Sbjct: 41 VEPELPYGNFKEMGKSIHPAHLSQRFYEQYKAVPGSPGFV------GLYIFLNP 88 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 288 VDGSLFEETPYLSLLSRKY 232 VDG+ +ETP SL S ++ Sbjct: 455 VDGAFLDETPQRSLASGRF 473 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 288 VDGSLFEETPYLSLLSRKY 232 VDG+ +ETP SL S ++ Sbjct: 455 VDGAFLDETPQRSLASGRF 473 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 288 VDGSLFEETPYLSLLSRKY 232 VDG+ +ETP SL S ++ Sbjct: 341 VDGAFLDETPQRSLASGRF 359 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 612,373 Number of Sequences: 2352 Number of extensions: 11270 Number of successful extensions: 17 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -