BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0893 (848 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 2.7 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 2.7 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 23 3.6 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 4.7 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 8.2 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 8.2 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 8.2 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 23.4 bits (48), Expect = 2.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +1 Query: 544 AIVWKEDTFFFQG 582 A +WK DT+F+ G Sbjct: 83 ARIWKPDTYFYNG 95 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 23.4 bits (48), Expect = 2.7 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = -1 Query: 629 YSCARTRLLSKRQKRGPWKKNVSSFQTIAASTGYGTSRHVAY 504 Y+C RT ++ W + FQTI T G SR Y Sbjct: 172 YNCKRTATITAATDCQLWAIDRQCFQTIMMRT--GLSRQAEY 211 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 23.0 bits (47), Expect = 3.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 693 SKVISKLDSQSKPYLCGRERVVLV 622 SK I+ ++ P++C RERV V Sbjct: 156 SKRITASEALKHPWICQRERVASV 179 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 22.6 bits (46), Expect = 4.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 649 QIWFRLRIQLRNDLTTPST 705 Q W LR+ L ++LT ST Sbjct: 154 QTWHDLRVALTSELTAAST 172 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +2 Query: 416 YNNRTYLIEEERYWRYDELTGTMDEDY 496 + T +E R W + T T D+DY Sbjct: 349 FQKNTTGLERSRSWSSLDNTNTNDQDY 375 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.8 bits (44), Expect = 8.2 Identities = 5/11 (45%), Positives = 9/11 (81%) Frame = +1 Query: 550 VWKEDTFFFQG 582 +W+ DT+F+ G Sbjct: 117 IWRPDTYFYNG 127 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 8.2 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 574 FQGPRFWRFDNNLVRAHEYYPLP 642 F+ R WR NNL +YP P Sbjct: 213 FRNSRSWRITNNL-----FYPYP 230 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 246,754 Number of Sequences: 438 Number of extensions: 6387 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27309825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -