BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0892 (792 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 23 2.1 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 22 4.9 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +1 Query: 340 KVLEKYY--VREAKTPRNSPFTFEDDGFYRTLKRAVVEELKKVP 465 ++ EK Y +R+ + P TF D + L+R ++E L+ P Sbjct: 17 EIQEKVYQELRDIFQDSDRPITFNDTLQMKYLERVLLETLRMYP 60 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -2 Query: 701 YSEIPIRPQTQIEQVHSPISFPVDVIVSGNCD 606 +S I P+T +E SP + P + +CD Sbjct: 23 FSISSILPETALEAPKSPENHPETELSDSDCD 54 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,075 Number of Sequences: 336 Number of extensions: 4005 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21480183 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -