BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0892 (792 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0889 - 32532495-32533832,32533919-32534151,32534321-325344... 31 0.79 08_02_0958 - 23044708-23046045,23046131-23046363,23047059-230471... 31 1.4 08_02_0956 + 23026108-23027146,23027255-23027395,23029334-230295... 31 1.4 04_01_0099 + 1029785-1030039,1030269-1030357,1030484-1030541,103... 30 1.8 05_02_0148 - 7085892-7086011,7086681-7087004,7088258-7088419,708... 29 4.2 09_06_0008 - 20168429-20170054 28 7.4 02_04_0499 - 23485707-23485822,23485899-23486112,23486464-234865... 28 7.4 >02_05_0889 - 32532495-32533832,32533919-32534151,32534321-32534461, 32534564-32535521 Length = 889 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +1 Query: 238 FPREASGGAEWLELSKGTDITEAFESHHLNSSVNKVLEKYYVRE 369 F ++ GGA+ + ++ GTD TE F++ H + +LE Y + E Sbjct: 544 FLKDHPGGADSIMINAGTDCTEEFDAIH-SDKARGLLEMYRIGE 586 >08_02_0958 - 23044708-23046045,23046131-23046363,23047059-23047199, 23047296-23048334 Length = 916 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +1 Query: 238 FPREASGGAEWLELSKGTDITEAFESHHLNSSVNKVLEKYYVREAKT 378 F ++ GGA+ + ++ GTD TE F++ H + +L+ Y + E T Sbjct: 572 FLKDHPGGADSILINAGTDCTEEFDAIH-SDKAKALLDTYRIGELIT 617 >08_02_0956 + 23026108-23027146,23027255-23027395,23029334-23029566, 23029652-23030989 Length = 916 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = +1 Query: 238 FPREASGGAEWLELSKGTDITEAFESHHLNSSVNKVLEKYYVREAKT 378 F ++ GGA+ + ++ GTD TE F++ H + +L+ Y + E T Sbjct: 572 FLKDHPGGADSILINAGTDCTEEFDAIH-SDKAKALLDTYRIGELIT 617 >04_01_0099 + 1029785-1030039,1030269-1030357,1030484-1030541, 1030643-1030960,1031043-1031165,1031698-1031901, 1031982-1032041 Length = 368 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +3 Query: 561 VVMSAYLIASLSLAWVTVAAHNYIHRKTNWRMYLFNLSLWS 683 ++ SA+ AS SL W V H Y +R W M+L L L+S Sbjct: 7 LLRSAFGKASPSLGWFIVNPHRYSYRW--WHMFLIMLVLYS 45 >05_02_0148 - 7085892-7086011,7086681-7087004,7088258-7088419, 7088866-7089066,7089148-7089332,7089459-7089588 Length = 373 Score = 29.1 bits (62), Expect = 4.2 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = +3 Query: 492 DHRWSLATLLISSAVSCWANDYWVVMSAYLIASLSLAWVTVAAHNYIHR-KTNWRMYLFN 668 D ++S+ +L+ AV C D V S LIA++ W T +Y+H + + + FN Sbjct: 130 DTKFSIMVVLVGVAV-CTVTDV-SVNSQGLIAAIIAVWSTALQQHYVHHLQRKYSLGSFN 187 Query: 669 L 671 L Sbjct: 188 L 188 >09_06_0008 - 20168429-20170054 Length = 541 Score = 28.3 bits (60), Expect = 7.4 Identities = 21/71 (29%), Positives = 31/71 (43%) Frame = +3 Query: 501 WSLATLLISSAVSCWANDYWVVMSAYLIASLSLAWVTVAAHNYIHRKTNWRMYLFNLSLW 680 WSL L + S +S +W + L L+ VAA + + T+ +Y+F SL Sbjct: 280 WSLVRLSVHSCMSVCLEWWWYEIMVLLCGVLADPKAAVAAMGVLIQTTS-LIYIFPHSLG 338 Query: 681 SYRDFRVSHAL 713 RV H L Sbjct: 339 CAVSTRVGHEL 349 >02_04_0499 - 23485707-23485822,23485899-23486112,23486464-23486511, 23486609-23486695,23486808-23486945,23487159-23487389, 23488524-23489504 Length = 604 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 Query: 669 LSLWSYRDFRVSHALSHHLYPNTLYGFRS*RIEPLVI 779 L+ + Y HA++HHL TL RS RI P V+ Sbjct: 210 LARYGYSGGDAVHAVAHHLADLTLLDRRSLRIPPSVV 246 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,708,177 Number of Sequences: 37544 Number of extensions: 433393 Number of successful extensions: 1054 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1054 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2138915688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -