BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0891 (619 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) 62 3e-10 SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) 62 3e-10 SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) 62 3e-10 SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) 62 3e-10 SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) 62 3e-10 SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) 62 3e-10 SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) 60 1e-09 SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) 59 2e-09 SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) 59 2e-09 SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) 56 2e-08 SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) 56 2e-08 SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 56 2e-08 SB_10470| Best HMM Match : Herpes_UL33 (HMM E-Value=1.8) 56 2e-08 SB_14797| Best HMM Match : RVT_1 (HMM E-Value=7.9e-33) 56 3e-08 SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_11851| Best HMM Match : IncFII_repA (HMM E-Value=1.4) 56 3e-08 SB_8080| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_48125| Best HMM Match : RVT_1 (HMM E-Value=8.4e-38) 54 7e-08 SB_3992| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044) 54 9e-08 SB_58171| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_39669| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) 54 1e-07 SB_22068| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_798| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_53800| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_38467| Best HMM Match : RVT_1 (HMM E-Value=4.2e-05) 54 1e-07 SB_36163| Best HMM Match : RVT_1 (HMM E-Value=4.2e-11) 54 1e-07 SB_27268| Best HMM Match : RVT_1 (HMM E-Value=2.24208e-44) 54 1e-07 SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) 53 2e-07 SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_12012| Best HMM Match : DUF327 (HMM E-Value=2) 53 2e-07 SB_37633| Best HMM Match : DUF327 (HMM E-Value=2.1) 53 2e-07 SB_34368| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_36088| Best HMM Match : RVT_1 (HMM E-Value=9e-12) 52 3e-07 SB_7972| Best HMM Match : RVT_1 (HMM E-Value=5.8e-29) 52 3e-07 SB_5046| Best HMM Match : GST_N (HMM E-Value=2.5e-05) 52 3e-07 SB_30213| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) 52 5e-07 SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) 51 7e-07 SB_27420| Best HMM Match : PHB_acc (HMM E-Value=6.6) 51 7e-07 SB_6009| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) 51 7e-07 SB_39089| Best HMM Match : RVT_1 (HMM E-Value=2.2e-20) 51 9e-07 SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 51 9e-07 SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) 51 9e-07 SB_23765| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_4524| Best HMM Match : Ribosomal_S7e (HMM E-Value=0.59) 51 9e-07 SB_3348| Best HMM Match : Borrelia_orfA (HMM E-Value=0.71) 51 9e-07 SB_38898| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 50 1e-06 SB_32540| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 50 1e-06 SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41) 50 1e-06 SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) 50 1e-06 SB_48325| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) 50 1e-06 SB_33122| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 50 1e-06 SB_14369| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 50 1e-06 SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33) 50 1e-06 SB_8360| Best HMM Match : RVT_1 (HMM E-Value=3.6e-07) 50 1e-06 SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) 50 2e-06 SB_54198| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_11213| Best HMM Match : RVT_1 (HMM E-Value=6.4e-38) 50 2e-06 SB_43683| Best HMM Match : RVT_1 (HMM E-Value=0.024) 50 2e-06 SB_24580| Best HMM Match : zf-C2H2 (HMM E-Value=0) 50 2e-06 SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) 50 2e-06 SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36) 50 2e-06 SB_3609| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_21074| Best HMM Match : NadA (HMM E-Value=2) 49 3e-06 SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8) 49 3e-06 SB_9604| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) 49 3e-06 SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) 49 3e-06 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 49 3e-06 SB_4171| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) 49 3e-06 SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_799| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_28157| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_31593| Best HMM Match : Ribonuclease_3 (HMM E-Value=6.30024e-42) 48 8e-06 SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_27891| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 46 2e-05 SB_1758| Best HMM Match : RVT_1 (HMM E-Value=0) 46 2e-05 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 46 2e-05 SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) 46 2e-05 SB_10781| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_53427| Best HMM Match : RVT_1 (HMM E-Value=0.031) 46 2e-05 SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) 46 2e-05 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 46 2e-05 SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) 46 3e-05 SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_49613| Best HMM Match : Transposase_5 (HMM E-Value=0.033) 45 4e-05 SB_28047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_18971| Best HMM Match : PWP2 (HMM E-Value=4) 45 4e-05 SB_59377| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7) 45 6e-05 SB_35561| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00092) 45 6e-05 SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) 45 6e-05 SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7) 45 6e-05 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 45 6e-05 SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) 45 6e-05 SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) 45 6e-05 SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_6188| Best HMM Match : Transposase_23 (HMM E-Value=0.41) 44 8e-05 SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) 44 1e-04 SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) 44 1e-04 SB_41513| Best HMM Match : RVT_1 (HMM E-Value=8.9e-21) 44 1e-04 SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08) 44 1e-04 SB_27128| Best HMM Match : PADR1 (HMM E-Value=8.3) 44 1e-04 SB_20189| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) 44 1e-04 SB_7615| Best HMM Match : RVT_1 (HMM E-Value=1e-33) 44 1e-04 SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) 44 1e-04 SB_48371| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) 44 1e-04 SB_25914| Best HMM Match : IL1_propep (HMM E-Value=8.1) 44 1e-04 SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4888| Best HMM Match : DUF104 (HMM E-Value=7.3) 44 1e-04 SB_1851| Best HMM Match : RVT_1 (HMM E-Value=3.2e-16) 44 1e-04 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) 44 1e-04 SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45005| Best HMM Match : RVT_1 (HMM E-Value=6.6e-32) 43 2e-04 SB_17732| Best HMM Match : RVT_1 (HMM E-Value=1.5e-27) 43 2e-04 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 43 2e-04 SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04) 43 2e-04 SB_13949| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 43 2e-04 SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) 43 2e-04 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 43 2e-04 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 43 2e-04 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 43 2e-04 SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) 42 3e-04 SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) 42 3e-04 SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 42 3e-04 SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_576| Best HMM Match : RVT_1 (HMM E-Value=0) 42 3e-04 SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2) 42 3e-04 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 42 3e-04 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 42 3e-04 SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 42 3e-04 SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) 42 4e-04 SB_36120| Best HMM Match : zf-MIZ (HMM E-Value=3.9) 42 4e-04 SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) 42 4e-04 SB_15607| Best HMM Match : zf-MIZ (HMM E-Value=3.9) 42 4e-04 SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) 42 4e-04 SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) 42 4e-04 SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) 42 4e-04 SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) 42 5e-04 SB_39386| Best HMM Match : RVT_1 (HMM E-Value=7.1e-28) 42 5e-04 SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) 42 5e-04 SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) 42 5e-04 SB_31162| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) 42 5e-04 SB_5957| Best HMM Match : Chitin_synth_1 (HMM E-Value=9) 41 7e-04 SB_47691| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_53688| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_48302| Best HMM Match : HORMA (HMM E-Value=1.1) 40 0.001 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 40 0.001 SB_1875| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_58397| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_54849| Best HMM Match : HORMA (HMM E-Value=0.54) 40 0.001 SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_20057| Best HMM Match : RVT_1 (HMM E-Value=3e-13) 40 0.001 SB_13020| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58999| Best HMM Match : Exo_endo_phos (HMM E-Value=2.6) 40 0.002 SB_3017| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19) 40 0.002 SB_50655| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_22397| Best HMM Match : DAO (HMM E-Value=7.6e-06) 40 0.002 SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) 40 0.002 SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) 40 0.002 SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.003 SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15) 39 0.003 SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) 39 0.003 SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.003 SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.003 SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_19684| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.003 SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) 39 0.004 SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) 39 0.004 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_59519| Best HMM Match : RVT_1 (HMM E-Value=3.5e-11) 38 0.007 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 38 0.007 SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 38 0.007 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 38 0.007 SB_54393| Best HMM Match : RNA_pol_Rpc34 (HMM E-Value=9.3e-10) 38 0.007 SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) 38 0.007 SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_33535| Best HMM Match : RVT_1 (HMM E-Value=1.4013e-45) 38 0.009 SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) 38 0.009 SB_32319| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_20001| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17856| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57858| Best HMM Match : RNA_pol_A_CTD (HMM E-Value=5.7) 37 0.011 SB_25560| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 37 0.015 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 37 0.015 SB_31085| Best HMM Match : RVT_1 (HMM E-Value=0.0094) 37 0.015 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 37 0.015 SB_23472| Best HMM Match : HIT (HMM E-Value=0.43) 37 0.015 SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) 37 0.015 SB_14910| Best HMM Match : RVT_1 (HMM E-Value=0.47) 37 0.015 SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) 37 0.015 SB_56675| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-08) 37 0.015 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 37 0.015 SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) 37 0.015 SB_36757| Best HMM Match : RVT_1 (HMM E-Value=4.1e-28) 37 0.015 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 37 0.015 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 37 0.015 SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) 37 0.015 SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42) 37 0.015 SB_56872| Best HMM Match : RVT_1 (HMM E-Value=2.7e-30) 36 0.020 SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 36 0.020 SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.020 SB_38578| Best HMM Match : RVT_1 (HMM E-Value=0.018) 36 0.020 SB_8718| Best HMM Match : Lipase_GDSL (HMM E-Value=0.023) 36 0.020 SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 36 0.020 SB_59736| Best HMM Match : RVT_1 (HMM E-Value=8.2e-31) 36 0.020 SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) 36 0.020 SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) 36 0.020 SB_41989| Best HMM Match : RVT_1 (HMM E-Value=1.2e-33) 36 0.020 SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) 36 0.020 SB_28146| Best HMM Match : Na_Ca_ex (HMM E-Value=0.039) 36 0.020 SB_27722| Best HMM Match : RVT_1 (HMM E-Value=0.00011) 36 0.020 SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37) 36 0.020 SB_16993| Best HMM Match : RVT_1 (HMM E-Value=0.35) 36 0.020 SB_7284| Best HMM Match : F5_F8_type_C (HMM E-Value=7.3e-10) 36 0.020 SB_3080| Best HMM Match : Methylase_S (HMM E-Value=2.6) 36 0.020 SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) 36 0.026 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 36 0.026 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) 36 0.026 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) 36 0.026 SB_4188| Best HMM Match : 7tm_1 (HMM E-Value=9e-06) 36 0.035 SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_39518| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_37732| Best HMM Match : RVT_1 (HMM E-Value=2e-23) 36 0.035 SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_15184| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) 35 0.046 SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42) 35 0.046 SB_17488| Best HMM Match : Phi-29_GP3 (HMM E-Value=0.69) 35 0.046 SB_9841| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_33398| Best HMM Match : Sorb (HMM E-Value=9.9) 35 0.061 SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_27867| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) 34 0.080 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.080 SB_57037| Best HMM Match : RVT_1 (HMM E-Value=3.4e-15) 34 0.11 SB_42669| Best HMM Match : Sorb (HMM E-Value=9.2) 34 0.11 SB_33087| Best HMM Match : Fascin (HMM E-Value=8.9) 34 0.11 SB_13686| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_22732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-23) 34 0.11 SB_18097| Best HMM Match : NadA (HMM E-Value=2.2) 34 0.11 SB_14288| Best HMM Match : Sorb (HMM E-Value=9.9) 34 0.11 SB_45315| Best HMM Match : DUF1235 (HMM E-Value=2.3) 33 0.14 SB_40349| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_35755| Best HMM Match : RVT_1 (HMM E-Value=1.90001e-40) 33 0.14 SB_35248| Best HMM Match : DUF999 (HMM E-Value=2.7) 33 0.14 SB_5231| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_53833| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_42770| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_26363| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_12357| Best HMM Match : RVT_1 (HMM E-Value=7.69999e-41) 33 0.14 SB_10854| Best HMM Match : Hormone_4 (HMM E-Value=8.4) 33 0.19 SB_44324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 33 0.19 SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) 33 0.19 SB_10715| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_46891| Best HMM Match : RVT_1 (HMM E-Value=1.6e-05) 33 0.25 SB_29435| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_26303| Best HMM Match : Fascin (HMM E-Value=4.4) 33 0.25 SB_3473| Best HMM Match : Fascin (HMM E-Value=4.4) 33 0.25 SB_56177| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_42505| Best HMM Match : RVT_1 (HMM E-Value=3.9e-18) 33 0.25 SB_41541| Best HMM Match : RVT_1 (HMM E-Value=3.1e-17) 33 0.25 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_11864| Best HMM Match : RVT_1 (HMM E-Value=0.012) 33 0.25 SB_10495| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_10154| Best HMM Match : RVT_1 (HMM E-Value=4.3e-17) 33 0.25 SB_38793| Best HMM Match : RepA_N (HMM E-Value=3.4) 32 0.32 SB_33707| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 32 0.32 SB_29242| Best HMM Match : CIDE-N (HMM E-Value=5) 32 0.32 SB_21018| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_17137| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) 32 0.32 SB_10379| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_54400| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_42434| Best HMM Match : RVT_1 (HMM E-Value=2.7e-18) 32 0.32 SB_34652| Best HMM Match : Ank (HMM E-Value=3.8e-34) 32 0.32 SB_30161| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_25515| Best HMM Match : Complex1_LYR (HMM E-Value=9.6) 32 0.32 SB_9813| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) 32 0.43 SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) 32 0.43 SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) 32 0.43 SB_8622| Best HMM Match : RVT_1 (HMM E-Value=1.8e-35) 32 0.43 SB_4381| Best HMM Match : RVT_1 (HMM E-Value=3) 32 0.43 SB_39712| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) 31 0.57 SB_35814| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_20618| Best HMM Match : PSCyt1 (HMM E-Value=0.64) 31 0.57 SB_15188| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_7753| Best HMM Match : RVT_1 (HMM E-Value=0.089) 31 0.57 SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) 31 0.57 SB_5816| Best HMM Match : RVT_1 (HMM E-Value=3e-16) 31 0.57 SB_2100| Best HMM Match : PAPA-1 (HMM E-Value=0.75) 31 0.57 SB_142| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_50273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_47853| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_29550| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) 31 0.57 SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) 31 0.57 SB_12419| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.57 SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) 31 0.75 SB_33611| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 31 0.75 SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) 31 0.75 SB_50676| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_40027| Best HMM Match : RVT_1 (HMM E-Value=3.8e-11) 31 0.75 SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 31 0.75 SB_6973| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36) 31 0.75 SB_55916| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_36989| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) 31 0.99 SB_52564| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-09) 31 0.99 SB_47325| Best HMM Match : RVT_1 (HMM E-Value=2.2e-31) 31 0.99 SB_33259| Best HMM Match : RVT_1 (HMM E-Value=4.3e-12) 31 0.99 SB_7055| Best HMM Match : RVT_1 (HMM E-Value=0.00051) 31 0.99 SB_30911| Best HMM Match : TT_ORF2 (HMM E-Value=1.1) 30 1.3 SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) 30 1.3 SB_27204| Best HMM Match : RVT_1 (HMM E-Value=0.00085) 30 1.3 SB_25070| Best HMM Match : RVT_1 (HMM E-Value=1.4e-15) 30 1.3 SB_24508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_21602| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55170| Best HMM Match : RVT_1 (HMM E-Value=0.16) 30 1.3 SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) 30 1.3 SB_40030| Best HMM Match : RVT_1 (HMM E-Value=0.0013) 30 1.3 SB_33916| Best HMM Match : Hormone_2 (HMM E-Value=8.8) 30 1.3 SB_31451| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_27170| Best HMM Match : RVT_1 (HMM E-Value=1.3e-31) 30 1.3 SB_1234| Best HMM Match : RVT_1 (HMM E-Value=3.1e-08) 30 1.3 SB_51001| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_30053| Best HMM Match : RVT_1 (HMM E-Value=2.3e-24) 30 1.7 SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) 30 1.7 SB_50830| Best HMM Match : RVT_1 (HMM E-Value=0.04) 30 1.7 SB_50409| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) 30 1.7 SB_31535| Best HMM Match : Oxysterol_BP (HMM E-Value=1.6e-08) 30 1.7 SB_21388| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_19635| Best HMM Match : Met_10 (HMM E-Value=3.4e-13) 30 1.7 SB_18722| Best HMM Match : RVT_1 (HMM E-Value=2.8e-08) 30 1.7 SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) 30 1.7 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_53343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_51005| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) 29 2.3 SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) 29 2.3 SB_46686| Best HMM Match : RVT_1 (HMM E-Value=0.00018) 29 2.3 SB_45791| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.2) 29 2.3 SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) 29 2.3 SB_39596| Best HMM Match : TTL (HMM E-Value=0) 29 2.3 SB_39094| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_35188| Best HMM Match : RVT_1 (HMM E-Value=2.3e-25) 29 2.3 SB_34658| Best HMM Match : SUI1 (HMM E-Value=1e-06) 29 2.3 SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) 29 2.3 SB_33430| Best HMM Match : RVT_1 (HMM E-Value=1.3e-26) 29 2.3 SB_29231| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_28387| Best HMM Match : RVT_1 (HMM E-Value=0.0013) 29 2.3 SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 29 2.3 SB_15148| Best HMM Match : Exo_endo_phos (HMM E-Value=3.3e-15) 29 2.3 SB_10873| Best HMM Match : Exo_endo_phos (HMM E-Value=0.068) 29 2.3 SB_6920| Best HMM Match : RVT_1 (HMM E-Value=2.7e-06) 29 2.3 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 29 2.3 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_47528| Best HMM Match : RVT_1 (HMM E-Value=9.9e-16) 29 2.3 SB_45907| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_43394| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_41708| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_32204| Best HMM Match : wnt (HMM E-Value=8.2e-31) 29 2.3 SB_31165| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_16359| Best HMM Match : RVT_1 (HMM E-Value=0.00049) 29 2.3 SB_12041| Best HMM Match : PHD (HMM E-Value=0.001) 29 2.3 SB_9990| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_54859| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.0 SB_36393| Best HMM Match : IF2_N (HMM E-Value=5.1) 29 3.0 SB_35480| Best HMM Match : RVT_1 (HMM E-Value=0.0085) 29 3.0 SB_34404| Best HMM Match : MtrG (HMM E-Value=6) 29 3.0 SB_32252| Best HMM Match : RVT_1 (HMM E-Value=9.2e-21) 29 3.0 SB_27763| Best HMM Match : VapD_N (HMM E-Value=10) 29 3.0 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.0 SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.0 SB_907| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27) 29 3.0 SB_57527| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_45895| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 29 3.0 SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.0 SB_34098| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.0 SB_29799| Best HMM Match : RVT_1 (HMM E-Value=3e-35) 29 3.0 SB_28679| Best HMM Match : RVT_1 (HMM E-Value=9.3e-08) 29 3.0 SB_25567| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.0 SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) 29 3.0 SB_20766| Best HMM Match : VapD_N (HMM E-Value=10) 29 3.0 SB_6031| Best HMM Match : RVT_1 (HMM E-Value=3.4) 29 3.0 SB_55618| Best HMM Match : RVT_1 (HMM E-Value=0.12) 29 4.0 SB_43399| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_11573| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_47841| Best HMM Match : E-MAP-115 (HMM E-Value=0.85) 29 4.0 SB_47788| Best HMM Match : Cir_Bir_Yir (HMM E-Value=8.6) 29 4.0 SB_19195| Best HMM Match : LEA_4 (HMM E-Value=0.00053) 29 4.0 SB_10046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) 29 4.0 SB_57821| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_53654| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_48318| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_40881| Best HMM Match : RVT_1 (HMM E-Value=2.9e-21) 28 5.3 SB_40620| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_38423| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) 28 5.3 SB_37487| Best HMM Match : RVT_1 (HMM E-Value=0.03) 28 5.3 SB_33347| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_33284| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36) 28 5.3 SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) 28 5.3 SB_17950| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_16177| Best HMM Match : SAM_1 (HMM E-Value=5.1) 28 5.3 SB_12043| Best HMM Match : RVT_1 (HMM E-Value=3.1) 28 5.3 SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_54068| Best HMM Match : RVT_1 (HMM E-Value=0.92) 28 5.3 SB_53855| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_52619| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_51950| Best HMM Match : DUF1531 (HMM E-Value=3.3) 28 5.3 SB_50128| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_45100| Best HMM Match : RVT_1 (HMM E-Value=0.022) 28 5.3 SB_42145| Best HMM Match : Candida_ALS (HMM E-Value=0.36) 28 5.3 SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_40322| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) 28 5.3 SB_40130| Best HMM Match : SAM_1 (HMM E-Value=5.1) 28 5.3 SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_20167| Best HMM Match : RhoGEF (HMM E-Value=0.73) 28 5.3 SB_19795| Best HMM Match : RVT_1 (HMM E-Value=1.3) 28 5.3 SB_14371| Best HMM Match : RVT_1 (HMM E-Value=2.2e-18) 28 5.3 SB_10707| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_6960| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 28 5.3 SB_54448| Best HMM Match : RVT_1 (HMM E-Value=0.096) 28 7.0 SB_50861| Best HMM Match : Borrelia_orfA (HMM E-Value=4.4) 28 7.0 SB_48511| Best HMM Match : Ank (HMM E-Value=4.6e-20) 28 7.0 SB_41718| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) 28 7.0 SB_37650| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_34166| Best HMM Match : RVT_1 (HMM E-Value=1e-23) 28 7.0 SB_27297| Best HMM Match : Bin3 (HMM E-Value=0.074) 28 7.0 SB_19821| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_16148| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 >SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 623 Score = 62.5 bits (145), Expect = 3e-10 Identities = 34/86 (39%), Positives = 48/86 (55%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP I K E D +AN+IL ++QFGFR HS V + T + + Sbjct: 197 YRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWYINM 256 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 +R+K +F D+ KAFD V H++ Sbjct: 257 DRQK--FNLVVFLDLKKAFDTVNHDI 280 Score = 36.3 bits (80), Expect = 0.020 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+ KL G+ +L+I+ YLSNR + ++ T S +T G+PQ Sbjct: 281 LLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVSSESKITCGIPQ 327 >SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 317 Score = 62.5 bits (145), Expect = 3e-10 Identities = 34/86 (39%), Positives = 48/86 (55%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP I K E D +AN+IL ++QFGFR HS V + T + + Sbjct: 23 YRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWYINM 82 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 +R+K +F D+ KAFD V H++ Sbjct: 83 DRQK--FNLVVFLDLKKAFDTVNHDI 106 Score = 36.3 bits (80), Expect = 0.020 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+ KL G+ +L+I+ YLSNR + ++ T S +T G+PQ Sbjct: 107 LLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVSSESKITCGIPQ 153 >SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 62.5 bits (145), Expect = 3e-10 Identities = 34/86 (39%), Positives = 48/86 (55%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP I K E D +AN+IL ++QFGFR HS V + T + + Sbjct: 441 YRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWYINM 500 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 +R+K +F D+ KAFD V H++ Sbjct: 501 DRQK--FNLVVFLDLKKAFDTVNHDI 524 Score = 36.3 bits (80), Expect = 0.020 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+ KL G+ +L+I+ YLSNR + ++ T S +T G+PQ Sbjct: 525 LLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVSSESKITCGIPQ 571 >SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 940 Score = 62.5 bits (145), Expect = 3e-10 Identities = 34/86 (39%), Positives = 48/86 (55%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP I K E D +AN+IL ++QFGFR HS V + T + + Sbjct: 507 YRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWYINM 566 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 +R+K +F D+ KAFD V H++ Sbjct: 567 DRQK--FNLVVFLDLKKAFDTVNHDI 590 Score = 36.3 bits (80), Expect = 0.020 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+ KL G+ +L+I+ YLSNR + ++ T S +T G+PQ Sbjct: 591 LLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVSSESKITCGIPQ 637 >SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1821 Score = 62.5 bits (145), Expect = 3e-10 Identities = 34/86 (39%), Positives = 48/86 (55%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP I K E D +AN+IL ++QFGFR HS V + T + + Sbjct: 1388 YRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWYINM 1447 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 +R+K +F D+ KAFD V H++ Sbjct: 1448 DRQK--FNLVVFLDLKKAFDTVNHDI 1471 Score = 33.9 bits (74), Expect = 0.11 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+ KL G+ +L+I+ YLSNR + ++ T S + G+PQ Sbjct: 1472 LLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVSSESKIQCGIPQ 1518 >SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 284 Score = 62.5 bits (145), Expect = 3e-10 Identities = 34/86 (39%), Positives = 48/86 (55%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP I K E D +AN+IL ++QFGFR HS V + T + + Sbjct: 23 YRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWYINM 82 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 +R+K +F D+ KAFD V H++ Sbjct: 83 DRQK--FNLVVFLDLKKAFDTVNHDI 106 Score = 36.3 bits (80), Expect = 0.020 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+ KL G+ +L+I+ YLSNR + ++ T S +T G+PQ Sbjct: 107 LLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVSSESKITCGIPQ 153 >SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 62.5 bits (145), Expect = 3e-10 Identities = 34/86 (39%), Positives = 48/86 (55%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP I K E D +AN+IL ++QFGFR HS V + T + + Sbjct: 704 YRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWYINM 763 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 +R+K +F D+ KAFD V H++ Sbjct: 764 DRQK--FNLVVFLDLKKAFDTVNHDI 787 Score = 36.3 bits (80), Expect = 0.020 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+ KL G+ +L+I+ YLSNR + ++ T S +T G+PQ Sbjct: 788 LLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVSSESKITCGIPQ 834 >SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 680 Score = 62.5 bits (145), Expect = 3e-10 Identities = 34/86 (39%), Positives = 48/86 (55%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP I K E D +AN+IL ++QFGFR HS V + T + + Sbjct: 247 YRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWYINM 306 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 +R+K +F D+ KAFD V H++ Sbjct: 307 DRQK--FNLVVFLDLKKAFDTVNHDI 330 Score = 36.3 bits (80), Expect = 0.020 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+ KL G+ +L+I+ YLSNR + ++ T S +T G+PQ Sbjct: 331 LLRKLELNGITGNALLLIQSYLSNRKQKCQLNSTVSSESKITCGIPQ 377 >SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) Length = 875 Score = 60.5 bits (140), Expect = 1e-09 Identities = 33/86 (38%), Positives = 47/86 (54%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP I K E D +AN+IL ++QFGFR HS V + T + + Sbjct: 197 YRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWYINM 256 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 +R+K +F D+ K FD V H++ Sbjct: 257 DRQK--FNLVVFLDLKKEFDTVNHDI 280 Score = 60.5 bits (140), Expect = 1e-09 Identities = 33/86 (38%), Positives = 47/86 (54%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP I K E D +AN+IL ++QFGFR HS V + T + + Sbjct: 486 YRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWYINM 545 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 +R+K +F D+ K FD V H++ Sbjct: 546 DRQK--FNLVVFLDLKKEFDTVNHDI 569 Score = 36.7 bits (81), Expect = 0.015 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+ KL G+ +L+I+ YLSNR + ++ T S +T G+PQ Sbjct: 281 LLQKLELNGITGNALLLIQSYLSNRKQKCQLNSTVSSESKITCGIPQ 327 >SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2362 Score = 59.3 bits (137), Expect = 2e-09 Identities = 32/86 (37%), Positives = 45/86 (52%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E F+ +N +L +QFGFR S V + + LL + Sbjct: 2151 YRPISILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLLNM 2210 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + K GA+F D+ KAFD V H + Sbjct: 2211 EQGK--LCGAVFIDLTKAFDTVDHEI 2234 >SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 630 Score = 59.3 bits (137), Expect = 2e-09 Identities = 32/86 (37%), Positives = 45/86 (52%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E F+ +N +L +QFGFR S V + + LL + Sbjct: 280 YRPISILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLLNM 339 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + K GA+F D+ KAFD V H + Sbjct: 340 EQGK--LCGAVFIDLTKAFDTVDHEI 363 Score = 28.3 bits (60), Expect = 5.3 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 ++ KL +G+ + R YL+NR+ R + S VT GVPQ Sbjct: 364 MLQKLTEIGLSGNPLAWFRSYLANRTQRTCCGNSLSEELPVTHGVPQ 410 >SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 59.3 bits (137), Expect = 2e-09 Identities = 32/86 (37%), Positives = 45/86 (52%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E F+ +N +L +QFGFR S V + + LL + Sbjct: 114 YRPISILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLLNM 173 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + K GA+F D+ KAFD V H + Sbjct: 174 EQGK--LCGAVFIDLTKAFDTVDHEI 197 >SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1182 Score = 59.3 bits (137), Expect = 2e-09 Identities = 32/86 (37%), Positives = 45/86 (52%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E F+ +N +L +QFGFR S V + + LL + Sbjct: 412 YRPISILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLLNM 471 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + K GA+F D+ KAFD V H + Sbjct: 472 EQGK--LCGAVFIDLTKAFDTVDHEI 495 >SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) Length = 365 Score = 59.3 bits (137), Expect = 2e-09 Identities = 32/86 (37%), Positives = 45/86 (52%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E F+ +N +L +QFGFR S V + + LL + Sbjct: 162 YRPISILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLLNM 221 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + K GA+F D+ KAFD V H + Sbjct: 222 EQGK--LCGAVFIDLTKAFDTVDHEI 245 >SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1855 Score = 57.2 bits (132), Expect = 1e-08 Identities = 32/86 (37%), Positives = 43/86 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS++P I K E D + N IL D QFGFR HS + T + + Sbjct: 537 YRPISIMPVISKLMENIMFEQLYDHLIKNNILSDHQFGFRKLHSTTSALLDCTNSWYVNM 596 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 +R+ + +F D+ KAFD V H V Sbjct: 597 DRK--LFNLVVFLDLKKAFDTVNHGV 620 Score = 40.3 bits (90), Expect = 0.001 Identities = 26/84 (30%), Positives = 35/84 (41%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+SL + K E +S + I+ Q GF+ SC Q+ L Sbjct: 1559 YRPVSLTSLVCKVMEHIVCKQLTSHLSEHSIISHHQHGFQKGLSCTTQLVSAIHDWASVL 1618 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + +F D AKAFD V H Sbjct: 1619 NAHGQV--DVIFLDFAKAFDSVPH 1640 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +IND+P ++ + LFADD+ +Y Sbjct: 1701 FINDMPSGIQSQVKLFADDSVLY 1723 >SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 291 Score = 56.0 bits (129), Expect = 2e-08 Identities = 31/85 (36%), Positives = 49/85 (57%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LPA+ K E ++++++K+L Q GFR HSC + +L ++ L+G Sbjct: 107 YRPISILPALSKVIERHIHVCLYEYLNSHKLLSSNQSGFRPYHSCDTALVKLIDY-LIG- 164 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + + +G D KAFD V H+ Sbjct: 165 NMDQGLISGLNLIDYRKAFDLVDHD 189 Score = 31.5 bits (68), Expect = 0.57 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 LI KL GV + + + YL +R + + G S + +TAGVPQ Sbjct: 191 LIKKLSIYGVSGKSLNWFKSYLEDRKQKVTISGQLSDSQPITAGVPQ 237 >SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 56.0 bits (129), Expect = 2e-08 Identities = 31/85 (36%), Positives = 49/85 (57%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LPA+ K E ++++++K+L Q GFR HSC + +L ++ L+G Sbjct: 107 YRPISILPALSKVIERHIHVCLYEYLNSHKLLSSNQSGFRPYHSCDTALVKLIDY-LIG- 164 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + + +G D KAFD V H+ Sbjct: 165 NMDQGLISGLNLIDYRKAFDLVDHD 189 Score = 31.5 bits (68), Expect = 0.57 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 LI KL GV + + + YL +R + + G S + +TAGVPQ Sbjct: 191 LIKKLSIYGVSGKSLNWFKSYLEDRKQKVTISGQLSDSQPITAGVPQ 237 >SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 377 Score = 56.0 bits (129), Expect = 2e-08 Identities = 31/85 (36%), Positives = 49/85 (57%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LPA+ K E ++++++K+L Q GFR HSC + +L ++ L+G Sbjct: 193 YRPISILPALSKVIERHIHVCLYEYLNSHKLLSSNQSGFRPYHSCDTALVKLIDY-LIG- 250 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + + +G D KAFD V H+ Sbjct: 251 NMDQGLISGLNLIDYRKAFDLVDHD 275 Score = 31.5 bits (68), Expect = 0.57 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 LI KL GV + + + YL +R + + G S + +TAGVPQ Sbjct: 277 LIKKLSIYGVSGKSLNWFKSYLEDRKQKVTISGQLSDSQPITAGVPQ 323 >SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 789 Score = 56.0 bits (129), Expect = 2e-08 Identities = 31/85 (36%), Positives = 49/85 (57%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LPA+ K E ++++++K+L Q GFR HSC + +L ++ L+G Sbjct: 521 YRPISILPALSKVIERHIHVCLYEYLNSHKLLSSNQSGFRPYHSCDTALIKLIDY-LIG- 578 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + + +G D KAFD V H+ Sbjct: 579 NMDQGLISGLNLIDYRKAFDLVDHD 603 Score = 30.7 bits (66), Expect = 0.99 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +I KL GV + + + YL +R + + G S + +TAGVPQ Sbjct: 605 IIKKLSIYGVSGKSLNWFKSYLEDRKQKVTISGQLSDSQPITAGVPQ 651 >SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 407 Score = 56.0 bits (129), Expect = 2e-08 Identities = 31/85 (36%), Positives = 49/85 (57%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LPA+ K E ++++++K+L Q GFR HSC + +L ++ L+G Sbjct: 107 YRPISILPALSKVIERHIHVCLYEYLNSHKLLSSNQSGFRPYHSCDTALIKLIDY-LIG- 164 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + + +G D KAFD V H+ Sbjct: 165 NMDQGLISGLNLIDYRKAFDLVDHD 189 Score = 30.7 bits (66), Expect = 0.99 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +I KL GV + + + YL +R + + G S + +TAGVPQ Sbjct: 191 IIKKLSIYGVSGKSLNWFKSYLEDRKQKVTISGQLSDSQPITAGVPQ 237 >SB_10470| Best HMM Match : Herpes_UL33 (HMM E-Value=1.8) Length = 170 Score = 56.0 bits (129), Expect = 2e-08 Identities = 31/92 (33%), Positives = 46/92 (50%) Frame = -3 Query: 527 EERNXXYRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTE 348 +E+ YRPIS+LP K YE +++ IL Q+GFR HS V E Sbjct: 76 KEQLKNYRPISILPCFSKLYEKAVYNQLISYINKCNILNINQYGFRHNHSTAMAVCDFVE 135 Query: 347 HXLLGLNRRKPIPTGALFFDIAKAFDKVWHNV 252 ++ K + T +F D++KAFD + HN+ Sbjct: 136 RITSVMD--KGLDTIGIFLDLSKAFDTLNHNI 165 >SB_14797| Best HMM Match : RVT_1 (HMM E-Value=7.9e-33) Length = 252 Score = 55.6 bits (128), Expect = 3e-08 Identities = 30/86 (34%), Positives = 44/86 (51%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLLP + +E ++ + IL QFGFR +HS H V + + + Sbjct: 36 YRPISLLPIFNQIFEKLICQRLNHYLQTHNILYSNQFGFRPKHSTTHAVLSVVDKIQKAI 95 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + G LF D++KAFD V H++ Sbjct: 96 ELGQ-FSCG-LFLDLSKAFDTVDHSI 119 >SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 55.6 bits (128), Expect = 3e-08 Identities = 31/85 (36%), Positives = 48/85 (56%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+ PA+ K E ++++++K+L Q GFR HSC + +L ++ L+G Sbjct: 373 YRPISISPALSKVIERHIHVCLYEYLNSHKLLSSNQSGFRPYHSCDTALVKLIDY-LIG- 430 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + + +G D KAFD V HN Sbjct: 431 NMDQGLISGLNLIDYRKAFDLVDHN 455 >SB_11851| Best HMM Match : IncFII_repA (HMM E-Value=1.4) Length = 401 Score = 55.6 bits (128), Expect = 3e-08 Identities = 30/86 (34%), Positives = 44/86 (51%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLLP + +E ++ + IL QFGFR +HS H V + + + Sbjct: 247 YRPISLLPIFNQIFEKLICQRLNHYLQTHNILYSNQFGFRPKHSTTHAVLSVVDKIQKAI 306 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + G LF D++KAFD V H++ Sbjct: 307 ELGQ-FSCG-LFLDLSKAFDTVDHSI 330 >SB_8080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 273 Score = 55.6 bits (128), Expect = 3e-08 Identities = 30/86 (34%), Positives = 44/86 (51%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLLP + +E ++ + IL QFGFR +HS H V + + + Sbjct: 36 YRPISLLPIFNQIFEKLICQRLNHYLQTHNILYSNQFGFRPKHSTTHAVLSVVDKIQKAI 95 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + G LF D++KAFD V H++ Sbjct: 96 ELGQ-FSCG-LFLDLSKAFDTVDHSI 119 >SB_48125| Best HMM Match : RVT_1 (HMM E-Value=8.4e-38) Length = 453 Score = 54.4 bits (125), Expect = 7e-08 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 2/102 (1%) Frame = -3 Query: 551 RXTXAGXTEERNXX--YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHS 378 R T +ER+ YRPIS+ P + K +E D++S N ++ Q GFR+ HS Sbjct: 66 RKTNNSTIKERSDINNYRPISVTPIVAKIFERTVYEQFYDYLSENHLISSFQSGFRSLHS 125 Query: 377 CVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVWHNV 252 V + + T+ ++ K +F D+ KAFD V H + Sbjct: 126 TVTALLKATDDWAFNID--KGNVNAVVFLDLKKAFDTVDHGI 165 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+ KL G+ + YL NR+ R V + S P+ +T G+PQ Sbjct: 166 LLSKLNFYGISGIAHEWFKSYLLNRTQRCSVNNSLSGPKFLTCGIPQ 212 >SB_3992| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 354 Score = 54.0 bits (124), Expect = 9e-08 Identities = 29/86 (33%), Positives = 45/86 (52%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS++ + K E F+ +KIL + QFGFR HS H + E + Sbjct: 202 YRPISIICSFSKILEKLIYNQLIFFLEKHKILFEFQFGFRKGHSTEHAILETVETLKSSI 261 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + + T A+F D +KAFD + H++ Sbjct: 262 D--QGMTTCAIFLDFSKAFDTINHDI 285 >SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044) Length = 1693 Score = 54.0 bits (124), Expect = 9e-08 Identities = 32/100 (32%), Positives = 45/100 (45%), Gaps = 3/100 (3%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR H+ H + + + Sbjct: 1596 YRPISLLSMFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRAI 1655 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCIT---WECQ 219 + + +F D +KAFD V H N +T W C+ Sbjct: 1656 EEGQ--YSCGIFLDFSKAFDTVDHKFLLANLLTTDSWNCK 1693 >SB_58171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 53.6 bits (123), Expect = 1e-07 Identities = 33/109 (30%), Positives = 51/109 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E D++ NK+L Q GFR H + ++ ++ L L Sbjct: 345 YRPISVLPILSKLVERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNLLFQL 404 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCR 183 + K +G L D KAFD V H + + + + S +E+ R Sbjct: 405 D--KNCVSGMLLIDYRKAFDMVDHIILMSKLKAYGLDKNTTSWFESYLR 451 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 3/28 (10%) Frame = -1 Query: 79 YINDIP---RSPETHLALFADDTAIYYS 5 +IND+P SP+ + L+ADDT I +S Sbjct: 487 FINDLPFHISSPKVKIDLYADDTTISFS 514 >SB_39669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 53.6 bits (123), Expect = 1e-07 Identities = 33/109 (30%), Positives = 51/109 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E D++ NK+L Q GFR H + ++ ++ L L Sbjct: 290 YRPISVLPILSKLVERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNLLFQL 349 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCR 183 + K +G L D KAFD V H + + + + S +E+ R Sbjct: 350 D--KNCVSGMLLIDYRKAFDMVDHIILMSKLKAYGLDKNTTSWFESYLR 396 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 3/28 (10%) Frame = -1 Query: 79 YINDIP---RSPETHLALFADDTAIYYS 5 +IND+P SP+ + L+ADDT I +S Sbjct: 432 FINDLPFHISSPKVKIDLYADDTTISFS 459 >SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) Length = 593 Score = 53.6 bits (123), Expect = 1e-07 Identities = 33/109 (30%), Positives = 51/109 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E D++ NK+L Q GFR H + ++ ++ L L Sbjct: 140 YRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNLLFQL 199 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCR 183 + K +G L D KAFD V H + + + + S +E+ R Sbjct: 200 D--KNCVSGMLLIDYRKAFDMVDHIILMSKLKAYGLDKNTTSWFESYLR 246 >SB_22068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 987 Score = 53.6 bits (123), Expect = 1e-07 Identities = 33/109 (30%), Positives = 51/109 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E D++ NK+L Q GFR H + ++ ++ L L Sbjct: 733 YRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNLLFQL 792 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCR 183 + K +G L D KAFD V H + + + + S +E+ R Sbjct: 793 D--KNCVSGMLLIDYRKAFDMVDHIILMSKLKAYGLDKNTTSWFESYLR 839 >SB_798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 845 Score = 53.6 bits (123), Expect = 1e-07 Identities = 33/109 (30%), Positives = 51/109 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E D++ NK+L Q GFR H + ++ ++ L L Sbjct: 668 YRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNLLFQL 727 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCR 183 + K +G L D KAFD V H + + + + S +E+ R Sbjct: 728 D--KNCVSGMLLIDYRKAFDMVDHIILMSKLKAYGLDKNTTSWFESYLR 774 >SB_53800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 666 Score = 53.6 bits (123), Expect = 1e-07 Identities = 33/109 (30%), Positives = 51/109 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E D++ NK+L Q GFR H + ++ ++ L L Sbjct: 489 YRPISVLPILSKLVERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNLLFQL 548 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCR 183 + K +G L D KAFD V H + + + + S +E+ R Sbjct: 549 D--KNCVSGMLLIDYRKAFDMVDHIILMSKLKAYGLDKNTTSWFESYLR 595 >SB_38467| Best HMM Match : RVT_1 (HMM E-Value=4.2e-05) Length = 400 Score = 53.6 bits (123), Expect = 1e-07 Identities = 29/86 (33%), Positives = 43/86 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLLP + +E ++ + IL QFGFR +HS H V + + + Sbjct: 175 YRPISLLPIFNQIFEKLICQRLNHYLQTHNILYSNQFGFRPKHSTTHAVLSVVDKIQKAI 234 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + LF D +KAFD V H++ Sbjct: 235 ELGQ--YSCGLFLDPSKAFDTVDHSI 258 >SB_36163| Best HMM Match : RVT_1 (HMM E-Value=4.2e-11) Length = 258 Score = 53.6 bits (123), Expect = 1e-07 Identities = 33/109 (30%), Positives = 51/109 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E D++ NK+L Q GFR H + ++ ++ L L Sbjct: 59 YRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNLLFQL 118 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCR 183 + K +G L D KAFD V H + + + + S +E+ R Sbjct: 119 D--KNCVSGMLLIDYRKAFDMVDHIILMSKLKAYGLDKNTTSWFESYLR 165 >SB_27268| Best HMM Match : RVT_1 (HMM E-Value=2.24208e-44) Length = 548 Score = 53.6 bits (123), Expect = 1e-07 Identities = 33/109 (30%), Positives = 51/109 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E D++ NK+L Q GFR H + ++ ++ L L Sbjct: 272 YRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNLLFQL 331 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCR 183 + K +G L D KAFD V H + + + + S +E+ R Sbjct: 332 D--KNCVSGMLLIDYRKAFDMVDHIILMSKLKAYGLDKNTTSWFESYLR 378 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 3/28 (10%) Frame = -1 Query: 79 YINDIP---RSPETHLALFADDTAIYYS 5 +IND+P SP+ + L+ADDT I +S Sbjct: 414 FINDLPFHISSPKVKIDLYADDTTISFS 441 >SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) Length = 890 Score = 53.2 bits (122), Expect = 2e-07 Identities = 33/109 (30%), Positives = 51/109 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E D++ NK+L Q GFR H + ++ ++ L L Sbjct: 437 YRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNLLFQL 496 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCR 183 + K +G L D KAFD V H + + + + S +E+ R Sbjct: 497 D--KNCISGMLLIDYRKAFDMVDHIILMSKLKAYGLDKNTTSWFESYLR 543 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 3/28 (10%) Frame = -1 Query: 79 YINDIP---RSPETHLALFADDTAIYYS 5 +IND+P SP+ + L+ADDT I +S Sbjct: 579 FINDLPFHISSPKVKIDLYADDTTISFS 606 >SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 52.8 bits (121), Expect = 2e-07 Identities = 29/86 (33%), Positives = 43/86 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLLP + +E ++ + IL FGFR +HS H V + + + Sbjct: 90 YRPISLLPIFNQIFEKLICQRLNHYLQTHNILHSNHFGFRPKHSTTHAVLSVVDKIQKAI 149 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + G LF D++KAFD V H++ Sbjct: 150 ELGQ-FSCG-LFLDLSKAFDTVDHSI 173 >SB_12012| Best HMM Match : DUF327 (HMM E-Value=2) Length = 232 Score = 52.8 bits (121), Expect = 2e-07 Identities = 30/84 (35%), Positives = 42/84 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E D++ NK+L Q GFR H + ++ ++ L L Sbjct: 140 YRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNLLFQL 199 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + K +G L D KAFD V H Sbjct: 200 D--KNCVSGMLLIDYRKAFDMVDH 221 >SB_37633| Best HMM Match : DUF327 (HMM E-Value=2.1) Length = 355 Score = 52.8 bits (121), Expect = 2e-07 Identities = 30/84 (35%), Positives = 42/84 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E D++ NK+L Q GFR H + ++ ++ L L Sbjct: 255 YRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNLLFQL 314 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + K +G L D KAFD V H Sbjct: 315 D--KNCVSGMLLIDYRKAFDMVDH 336 >SB_34368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 52.8 bits (121), Expect = 2e-07 Identities = 29/86 (33%), Positives = 45/86 (52%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+S+LP K +E +F+ IL + Q+GFR HS V + L + + Sbjct: 283 YRPVSVLPVFSKFFEKVVYKRLYNFLIKYDILSNNQYGFRKNHSTVLALLHLYDTLSSAI 342 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + +K T +F D++KAFD V H + Sbjct: 343 DYKK--YTLGVFIDLSKAFDTVNHGI 366 >SB_36088| Best HMM Match : RVT_1 (HMM E-Value=9e-12) Length = 471 Score = 52.4 bits (120), Expect = 3e-07 Identities = 33/109 (30%), Positives = 49/109 (44%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E D++ NK+L Q GFR H + + ++ L L Sbjct: 272 YRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKAVDNLLFQL 331 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCR 183 + K G L D KAFD V H + + + + S +E+ R Sbjct: 332 D--KNCVNGMLLIDYRKAFDMVDHIILMSKLKAYGLDKNTTSWFESYLR 378 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 3/28 (10%) Frame = -1 Query: 79 YINDIP---RSPETHLALFADDTAIYYS 5 +IND+P SP+ + L+ADDT I +S Sbjct: 414 FINDLPFHISSPKVKIDLYADDTTISFS 441 >SB_7972| Best HMM Match : RVT_1 (HMM E-Value=5.8e-29) Length = 382 Score = 52.4 bits (120), Expect = 3e-07 Identities = 29/86 (33%), Positives = 43/86 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YR ISLLP + +E ++ + IL QFGFR +HS H V + + + Sbjct: 170 YRSISLLPIFNQIFEKLICQRLNHYLQTHNILYSNQFGFRPKHSTTHAVLSVVDKIQKAI 229 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + G LF D++KAFD V H++ Sbjct: 230 ELGQ-FSCG-LFLDLSKAFDTVDHSI 253 >SB_5046| Best HMM Match : GST_N (HMM E-Value=2.5e-05) Length = 280 Score = 52.4 bits (120), Expect = 3e-07 Identities = 31/84 (36%), Positives = 38/84 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+SL + K E + IL D Q FRA HSC+ Q+ + L L Sbjct: 85 YRPVSLTCIVCKLLEHIVYSNLMLHIDTYNILTDRQHAFRASHSCLTQLCHVVNDWALAL 144 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 NR + T A D AK FD V H Sbjct: 145 NR--GLQTDAFILDFAKEFDSVPH 166 >SB_30213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 52.0 bits (119), Expect = 4e-07 Identities = 28/86 (32%), Positives = 42/86 (48%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K +E F++ IL D+QFGFR +H+ H + + + Sbjct: 4 YRPISLLSIFNKSWEKLMYKRLIAFINKYNILYDKQFGFREQHTTFHATLLIVDKIQRAI 63 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 64 EEGQ--YSCGIFLDFSKAFDTVDHKI 87 >SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) Length = 323 Score = 51.6 bits (118), Expect = 5e-07 Identities = 28/86 (32%), Positives = 41/86 (47%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL + + YE F+ N +L Q+GFR HS H + + Sbjct: 19 YRPISLLSNLNRIYEKLVYTKMVSFIEDNGLLYKAQYGFRKSHSTQHATLDIINTIQRNM 78 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + R + +F D+ KAFD V H++ Sbjct: 79 DNR--FYSCGIFLDLKKAFDTVDHDI 102 >SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) Length = 325 Score = 51.2 bits (117), Expect = 7e-07 Identities = 43/140 (30%), Positives = 59/140 (42%), Gaps = 3/140 (2%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+SL + K E + + N IL Q GFR HSC Q+ E L Sbjct: 115 YRPVSLTTVLCKLMEHVIYKNIMEHLENNNILFANQHGFRKNHSCETQLLLTVED--LAR 172 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYET--TCRTVRSDIESR 156 N L D +KAFDKV H + + + Q + + ++ T RT R ++ Sbjct: 173 NTDNGGQIDMLILDFSKAFDKVAHGRLISKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGV 232 Query: 155 ERVPGPVTS-QPESRKLRPL 99 P VTS P+ L PL Sbjct: 233 SSKPVDVTSGVPQGTVLGPL 252 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RLI KL G+ R + I+ +L+NR+ R V+G S+P VT+GVPQ Sbjct: 198 RLISKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQ 245 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIYY 8 +IND+ + E L LFADD +Y+ Sbjct: 257 FINDMQENLECTLRLFADDALLYH 280 >SB_27420| Best HMM Match : PHB_acc (HMM E-Value=6.6) Length = 291 Score = 51.2 bits (117), Expect = 7e-07 Identities = 28/86 (32%), Positives = 41/86 (47%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL + + YE F+ N +L Q+GFR HS H + + Sbjct: 204 YRPISLLSNLNRIYEKLVYTKMVSFIEDNGLLYKAQYGFRKSHSTQHATLDIINTIHRNM 263 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + R + +F D+ KAFD V H++ Sbjct: 264 DNR--FYSCGIFLDLKKAFDTVDHDI 287 >SB_6009| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 895 Score = 51.2 bits (117), Expect = 7e-07 Identities = 28/86 (32%), Positives = 44/86 (51%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+S+LP K +E +F+ IL + Q+GFR HS + L + + Sbjct: 773 YRPVSVLPVFSKFFEKVVYKRLYNFLVKYDILSNNQYGFRKNHSTALALLHLYDTLSSAI 832 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + +K T +F D++KAFD V H + Sbjct: 833 DYKK--YTLGVFIDLSKAFDTVNHGI 856 >SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 423 Score = 51.2 bits (117), Expect = 7e-07 Identities = 43/140 (30%), Positives = 59/140 (42%), Gaps = 3/140 (2%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+SL + K E + + N IL Q GFR HSC Q+ E L Sbjct: 115 YRPVSLTTVLCKLMEHVIYKNIMEHLENNNILFANQHGFRKNHSCETQLLLTVED--LAR 172 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYET--TCRTVRSDIESR 156 N L D +KAFDKV H + + + Q + + ++ T RT R ++ Sbjct: 173 NTDNGGQIDMLILDFSKAFDKVAHGRLISKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGV 232 Query: 155 ERVPGPVTS-QPESRKLRPL 99 P VTS P+ L PL Sbjct: 233 SSKPVDVTSGVPQGTVLGPL 252 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RLI KL G+ R + I+ +L+NR+ R V+G S+P VT+GVPQ Sbjct: 198 RLISKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQ 245 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIYY 8 +IND+ + E L LFADD +Y+ Sbjct: 257 FINDMQENLECTLRLFADDALLYH 280 >SB_39089| Best HMM Match : RVT_1 (HMM E-Value=2.2e-20) Length = 396 Score = 50.8 bits (116), Expect = 9e-07 Identities = 28/86 (32%), Positives = 41/86 (47%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR +H+ H + + + Sbjct: 4 YRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREQHTTFHATLLIVDKIQRAI 63 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 64 EEGQ--YSCGIFLDFSKAFDTVDHKI 87 >SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) Length = 1799 Score = 50.8 bits (116), Expect = 9e-07 Identities = 30/84 (35%), Positives = 41/84 (48%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E ++ +N I Q GFR RHS + + Sbjct: 1380 YRPISILPDVSKVLERVVHQQLTAYLQSNSIFSPYQCGFRKRHSTEWAAICFADS--VRR 1437 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + TGA+F D++KAFD V H Sbjct: 1438 NIDLGMMTGAMFIDLSKAFDTVCH 1461 >SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) Length = 1029 Score = 50.8 bits (116), Expect = 9e-07 Identities = 28/86 (32%), Positives = 41/86 (47%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR +H+ H + + + Sbjct: 718 YRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREQHTTFHATLLIVDKIQRAI 777 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 778 EEGQ--YSCGIFLDFSKAFDTVDHKI 801 >SB_23765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 50.8 bits (116), Expect = 9e-07 Identities = 28/86 (32%), Positives = 41/86 (47%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR +H+ H + + + Sbjct: 4 YRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREQHTTFHATLLIVDKIQRAI 63 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 64 EEGQ--YSCGIFLDFSKAFDTVDHKI 87 >SB_4524| Best HMM Match : Ribosomal_S7e (HMM E-Value=0.59) Length = 367 Score = 50.8 bits (116), Expect = 9e-07 Identities = 28/86 (32%), Positives = 41/86 (47%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR +H+ H + + + Sbjct: 236 YRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREQHTTFHATLLIVDKIQRAI 295 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 296 EEGQ--YSCGIFLDFSKAFDTVDHKI 319 >SB_3348| Best HMM Match : Borrelia_orfA (HMM E-Value=0.71) Length = 500 Score = 50.8 bits (116), Expect = 9e-07 Identities = 28/86 (32%), Positives = 41/86 (47%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR +H+ H + + + Sbjct: 369 YRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREQHTTFHATLLIVDKIQRAI 428 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 429 EEGQ--YSCGIFLDFSKAFDTVDHKI 452 >SB_38898| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR H+ H + + + Sbjct: 4 YRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRAI 63 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 64 EEGQ--YSCGIFLDFSKAFDTVDHKI 87 >SB_32540| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR H+ H + + + Sbjct: 4 YRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRAI 63 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 64 EEGQ--YSCGIFLDFSKAFDTVDHKI 87 >SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41) Length = 1047 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR H+ H + + + Sbjct: 817 YRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRAI 876 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 877 EEGQ--YSCGIFLDFSKAFDTVDHKI 900 >SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) Length = 1078 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR H+ H + + + Sbjct: 471 YRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRAI 530 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 531 EEGQ--YSCGIFLDFSKAFDTVDHKI 554 >SB_48325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 872 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR H+ H + + + Sbjct: 667 YRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRAI 726 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 727 EEGQ--YSCGIFLDFSKAFDTVDHKI 750 >SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) Length = 439 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR H+ H + + + Sbjct: 4 YRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRAI 63 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 64 EEGQ--YSCGIFLDFSKAFDTVDHKI 87 >SB_33122| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR H+ H + + + Sbjct: 4 YRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRAI 63 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 64 EEGQ--YSCGIFLDFSKAFDTVDHKI 87 >SB_14369| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR H+ H + + + Sbjct: 4 YRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRAI 63 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 64 EEGQ--YSCGIFLDFSKAFDTVDHKI 87 >SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33) Length = 759 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR H+ H + + + Sbjct: 543 YRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRAI 602 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 603 EEGQ--YSCGIFLDFSKAFDTVDHKI 626 >SB_8360| Best HMM Match : RVT_1 (HMM E-Value=3.6e-07) Length = 468 Score = 50.4 bits (115), Expect = 1e-06 Identities = 28/86 (32%), Positives = 40/86 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL K E F++ IL D+QFGFR H+ H + + + Sbjct: 273 YRPISLLSIFNKILEKLTYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRAI 332 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + +F D +KAFD V H + Sbjct: 333 EEGQ--YSCGIFLDFSKAFDTVDHKI 356 >SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) Length = 1054 Score = 50.0 bits (114), Expect = 2e-06 Identities = 27/82 (32%), Positives = 42/82 (51%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP I K E ++ N ++ + QFGFR HS + + T L+ + Sbjct: 706 YRPISILPVISKIMERILSNQLYKYLLKNSLISNHQFGFRRLHSTMSALLDCTNSWLINM 765 Query: 329 NRRKPIPTGALFFDIAKAFDKV 264 +R+ + + D+ KAFD V Sbjct: 766 DRK--MFNLVVLLDLKKAFDTV 785 >SB_54198| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 50.0 bits (114), Expect = 2e-06 Identities = 31/84 (36%), Positives = 40/84 (47%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPI L I K E + A++IL D Q FR +HSCV Q+ + L Sbjct: 78 YRPIPLTSVICKILEHIVCSHINRHLEAHQILSDRQHAFRKKHSCVTQLCFVINDWASTL 137 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 +R + T A D AKAFD + H Sbjct: 138 DRG--LQTDAFVLDFAKAFDSIPH 159 >SB_11213| Best HMM Match : RVT_1 (HMM E-Value=6.4e-38) Length = 510 Score = 50.0 bits (114), Expect = 2e-06 Identities = 32/84 (38%), Positives = 40/84 (47%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL I K E + A++IL D Q FR + SCV Q+ + L Sbjct: 116 YRPISLTSVICKILEHIVCSHINRHLEAHQILSDRQHAFRKKRSCVTQLCFVINDWASAL 175 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 +R + T A D AKAFD V H Sbjct: 176 DR--GLQTDAFVLDFAKAFDSVPH 197 Score = 34.7 bits (76), Expect = 0.061 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 1/73 (1%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQAPP-SPRYYSV 82 +RL KLY+ G+ + + I +L R R V G +S VT+GVPQ P +++ Sbjct: 198 ERLKSKLYSYGIGGQTLKWIDAFLYERYQRVCVNGAKSSWTRVTSGVPQGTVLGPVLFNL 257 Query: 81 CISMIYPGLRRPI 43 I+ I +R I Sbjct: 258 FINDIQESVRSEI 270 >SB_43683| Best HMM Match : RVT_1 (HMM E-Value=0.024) Length = 474 Score = 49.6 bits (113), Expect = 2e-06 Identities = 28/86 (32%), Positives = 43/86 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+S+LP K +E +F+ IL +Q+GFR HS + L + + Sbjct: 92 YRPVSVLPVFSKIFEKVVYKRLYNFLIKYDILSKKQYGFRKNHSTALALLHLYDTLSNAI 151 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + +K G F D++KAFD V H + Sbjct: 152 DYKKYTLGG--FIDLSKAFDTVNHGI 175 >SB_24580| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 366 Score = 49.6 bits (113), Expect = 2e-06 Identities = 28/86 (32%), Positives = 42/86 (48%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E F+++++++ Q GFR HSC + L + L Sbjct: 40 YRPISILPILSKILERHVHVQLYAFLNSHQLITHRQSGFRPYHSCETAMIELVDTLL--K 97 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 N + G D KAFD V H++ Sbjct: 98 NMDDGLINGLALIDYRKAFDLVDHDI 123 >SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 393 Score = 49.6 bits (113), Expect = 2e-06 Identities = 42/140 (30%), Positives = 59/140 (42%), Gaps = 3/140 (2%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+SL + K E + + N IL Q GFR HSC Q+ E L Sbjct: 115 YRPVSLTTVLCKLMEHVIYKNIMEHLENNNILFANQHGFRKNHSCETQLLLTVED--LAR 172 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYET--TCRTVRSDIESR 156 N L D +KAFDKV H + + + + + + ++ T RT R ++ Sbjct: 173 NTDNGGQIDMLILDFSKAFDKVAHGRLISKLLYYGIRGRTLAWIKSWLTNRTQRVVVDGV 232 Query: 155 ERVPGPVTS-QPESRKLRPL 99 P VTS P+ L PL Sbjct: 233 SSKPVDVTSGVPQGTVLGPL 252 Score = 43.6 bits (98), Expect = 1e-04 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RLI KL G+ R + I+ +L+NR+ R V+G S+P VT+GVPQ Sbjct: 198 RLISKLLYYGIRGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQ 245 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIYY 8 +IND+ + E L LFADD +Y+ Sbjct: 257 FINDMQENLECTLRLFADDALLYH 280 >SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36) Length = 449 Score = 49.6 bits (113), Expect = 2e-06 Identities = 26/86 (30%), Positives = 46/86 (53%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS++P + K E ++ N IL + Q FR+++S ++ + T L + Sbjct: 223 YRPISIIPVVSKICERTIFDQLYKYLKDNNILHECQSCFRSQYSTLNSLIEATNEWFLNI 282 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + + +F D+AKAFD V H++ Sbjct: 283 D--QGLINAVVFVDLAKAFDTVNHDI 306 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/47 (42%), Positives = 29/47 (61%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 LI+KL G+ + ++ IR YL+ RS + V G S PR ++ GVPQ Sbjct: 307 LIHKLAKYGLRESSLIWIRSYLTGRSQKCFVNGDLSSPRPISCGVPQ 353 >SB_3609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 49.6 bits (113), Expect = 2e-06 Identities = 27/86 (31%), Positives = 44/86 (51%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+S+L I K +E D + + + GF HSC + +LTE L Sbjct: 10 YRPVSVLSTIPKIFERLQFDQLYDAFAM--VFSNNMSGFLRGHSCCSALIKLTEDWRASL 67 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 ++R+ + G + D++KAFD + HN+ Sbjct: 68 DKRESV--GVVAIDLSKAFDSICHNL 91 >SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 48.8 bits (111), Expect = 3e-06 Identities = 32/85 (37%), Positives = 39/85 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + N IL D Q GFR+ SC Q+ T L Sbjct: 403 YRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDLQHGFRSGFSCETQLVLTTYDWATSL 462 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + + AL D +KAFDKV H+ Sbjct: 463 NNQGQV--DALLLDFSKAFDKVSHS 485 Score = 34.7 bits (76), Expect = 0.061 Identities = 22/62 (35%), Positives = 32/62 (51%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL +S+ +L+YKL + G+ + I +LS R+ V GT S VT+GV Sbjct: 472 LLDFSKAFDKVSHSKLLYKLRSYGICGKTCQWITSFLSVRTQFVSVNGTHSSCTPVTSGV 531 Query: 117 PQ 112 PQ Sbjct: 532 PQ 533 Score = 32.7 bits (71), Expect = 0.25 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI +HL LFADDT +Y Sbjct: 545 FINDITLCTRSHLRLFADDTVVY 567 >SB_21074| Best HMM Match : NadA (HMM E-Value=2) Length = 358 Score = 48.8 bits (111), Expect = 3e-06 Identities = 32/85 (37%), Positives = 39/85 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + N IL D Q GFR+ SC Q+ T L Sbjct: 266 YRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDLQHGFRSGFSCETQLVLTTYDWATSL 325 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + + AL D +KAFDKV H+ Sbjct: 326 NNQGQV--DALLLDFSKAFDKVSHS 348 >SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8) Length = 339 Score = 48.8 bits (111), Expect = 3e-06 Identities = 32/85 (37%), Positives = 39/85 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + N IL D Q GFR+ SC Q+ T L Sbjct: 244 YRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDLQHGFRSGFSCETQLVLTTYDWATSL 303 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + + AL D +KAFDKV H+ Sbjct: 304 NNQGQV--DALLLDFSKAFDKVSHS 326 >SB_9604| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) Length = 317 Score = 48.8 bits (111), Expect = 3e-06 Identities = 26/86 (30%), Positives = 42/86 (48%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+S+LP K E F+ +L D Q+GF+ HS + L + + Sbjct: 177 YRPVSVLPIFSKFLEKIMYDRLYKFLIKYNLLFDNQYGFKKHHSTALALIHLYDKLSSAI 236 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + ++ T +F D++KAFD V H + Sbjct: 237 DNKE--FTMGVFIDLSKAFDVVNHEI 260 >SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 48.8 bits (111), Expect = 3e-06 Identities = 32/85 (37%), Positives = 39/85 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + N IL D Q GFR+ SC Q+ T L Sbjct: 86 YRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDLQHGFRSGFSCETQLVLTTYDWATSL 145 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + + AL D +KAFDKV H+ Sbjct: 146 NNQGQV--DALLLDFSKAFDKVSHS 168 >SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 402 Score = 48.8 bits (111), Expect = 3e-06 Identities = 32/85 (37%), Positives = 39/85 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + N IL D Q GFR+ SC Q+ T L Sbjct: 86 YRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDLQHGFRSGFSCETQLVLTTYDWATSL 145 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + + AL D +KAFDKV H+ Sbjct: 146 NNQGQV--DALLLDFSKAFDKVSHS 168 Score = 34.7 bits (76), Expect = 0.061 Identities = 22/62 (35%), Positives = 32/62 (51%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL +S+ +L+YKL + G+ + I +LS R+ V GT S VT+GV Sbjct: 155 LLDFSKAFDKVSHSKLLYKLRSYGICGKTCQWITSFLSVRTQFVSVNGTHSSCTPVTSGV 214 Query: 117 PQ 112 PQ Sbjct: 215 PQ 216 Score = 32.7 bits (71), Expect = 0.25 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI +HL LFADDT +Y Sbjct: 228 FINDITLCTRSHLRLFADDTVVY 250 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 48.8 bits (111), Expect = 3e-06 Identities = 32/85 (37%), Positives = 39/85 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + N IL D Q GFR+ SC Q+ T L Sbjct: 168 YRPISLTCICCKVMEHIVLSHLNSHTAMNNILSDLQHGFRSGFSCETQLVLTTYDWATSL 227 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + + AL D +KAFDKV H+ Sbjct: 228 NNQGQV--DALLLDFSKAFDKVSHS 250 Score = 32.7 bits (71), Expect = 0.25 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI +HL LFADDT +Y Sbjct: 278 FINDITLCTRSHLRLFADDTVVY 300 >SB_4171| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) Length = 243 Score = 48.8 bits (111), Expect = 3e-06 Identities = 26/86 (30%), Positives = 42/86 (48%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+S+LP K E F+ +L D Q+GF+ HS + L + + Sbjct: 103 YRPVSVLPIFSKFLEKIMYDRLYKFLIKYNLLFDNQYGFKKHHSTALALIHLYDKLSSAI 162 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + ++ T +F D++KAFD V H + Sbjct: 163 DNKE--FTMGVFIDLSKAFDVVNHEI 186 >SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 48.4 bits (110), Expect = 5e-06 Identities = 30/85 (35%), Positives = 41/85 (48%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + + AN +L Q GFR RHSC Q+ L + Sbjct: 167 YRPISLTCISCKLLEHIAASHVINHLEANGLLSPFQHGFRERHSCETQLLLTFNDLALAM 226 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 ++++ T L D +KAFD V H+ Sbjct: 227 DKKQ--QTDLLLLDFSKAFDSVSHS 249 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/62 (33%), Positives = 33/62 (53%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL +S+ RL+ KL + G+ ++ + D+ NR+ V+G S P VT+GV Sbjct: 236 LLDFSKAFDSVSHSRLLIKLQHYGISGQVYYWLEDFFKNRTQSVVVDGEHSSPAIVTSGV 295 Query: 117 PQ 112 PQ Sbjct: 296 PQ 297 >SB_799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 48.0 bits (109), Expect = 6e-06 Identities = 27/84 (32%), Positives = 40/84 (47%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS++P + K +E F+ + L Q GFR+ HS + + T+ + Sbjct: 289 YRPISVIPIVAKVFERIVYELFYAFLEKHDFLCKNQSGFRSIHSTMTALLEATDSWAYNI 348 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + K LF D+ KAFD V H Sbjct: 349 DTWK--INAVLFLDLKKAFDTVDH 370 >SB_28157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 48.0 bits (109), Expect = 6e-06 Identities = 33/84 (39%), Positives = 38/84 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + + AN L Q GFR RHSC Q+ L + L L Sbjct: 361 YRPISLTCISCKLLEHIVASHVMNHLEANGFLSPFQHGFRERHSCETQL--LLTYNDLAL 418 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 K T L D +KAFD V H Sbjct: 419 AMDKKQQTDLLLLDFSKAFDSVSH 442 Score = 37.1 bits (82), Expect = 0.011 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RL+ KL + + ++ + D+L NR+ V+G S P VT+GVPQ Sbjct: 444 RLLIKLQHYEISGQVYYWLEDFLKNRTQSVVVDGEHSSPAIVTSGVPQ 491 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YIND+P + LFADD A+Y Sbjct: 503 YINDLPDGINGKIRLFADDCALY 525 >SB_31593| Best HMM Match : Ribonuclease_3 (HMM E-Value=6.30024e-42) Length = 618 Score = 47.6 bits (108), Expect = 8e-06 Identities = 30/84 (35%), Positives = 36/84 (42%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+SL + K E + + N IL Q GFR HSC Q+ E L Sbjct: 297 YRPVSLTTVLCKLMEHVIYKNIMEHLENNNILFANQHGFRKNHSCETQLLLTVED--LAR 354 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N L D +KAFDKV H Sbjct: 355 NTDNGGQIDMLILDFSKAFDKVAH 378 Score = 32.7 bits (71), Expect = 0.25 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRP 139 RLI KL G+ R + I+ +L+NR+ R V+G S+P Sbjct: 380 RLISKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGVSSKP 418 >SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 46.8 bits (106), Expect = 1e-05 Identities = 30/84 (35%), Positives = 42/84 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLLP I K E D ++ ++ + Q GF SC Q+ + H L Sbjct: 1571 YRPISLLPVISKVLERCVLANIRDHLTT--LINNVQHGFLPGKSCTTQLLEVLHHIGSLL 1628 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + K T ++ D++KAFDKV H Sbjct: 1629 DNGK--QTDVIYMDMSKAFDKVDH 1650 Score = 34.7 bits (76), Expect = 0.061 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -2 Query: 252 LIYKL-YNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L++KL ++ G+ L+ YLSNR R V G S VT+GVPQ Sbjct: 1653 LLHKLEHSFGISGSLLCWFHSYLSNRRQRVIVLGCTSSEASVTSGVPQ 1700 >SB_27891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 46.8 bits (106), Expect = 1e-05 Identities = 30/84 (35%), Positives = 42/84 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLLP I K E D ++ ++ + Q GF SC Q+ + H L Sbjct: 496 YRPISLLPVISKVLERCVLANIRDHLTT--LINNVQHGFLPGKSCTTQLLEVLRHIGSLL 553 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + K T ++ D++KAFDKV H Sbjct: 554 DNGK--QTDVIYMDMSKAFDKVDH 575 >SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) Length = 674 Score = 46.4 bits (105), Expect = 2e-05 Identities = 29/85 (34%), Positives = 42/85 (49%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 +RPIS+L + K + F+++ +L D QFGFR SC L++ L Sbjct: 214 FRPISVLCILSKVLKRDTYTSIYYFLTSQDLLTDFQFGFRWFRSCELATINLSDSIL--K 271 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + +G L D+ KAFD V HN Sbjct: 272 NMDNGLLSGMLLIDLKKAFDLVDHN 296 >SB_1758| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 359 Score = 46.4 bits (105), Expect = 2e-05 Identities = 30/84 (35%), Positives = 39/84 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E +S++ ILI++Q GFR + SC Q+ + Sbjct: 101 YRPISLTSICCKIMEHIILSHMAKHLSSHNILINQQHGFREKFSCETQLISAIHDWAKTI 160 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N R T L D +KAFD V H Sbjct: 161 NFRG--QTDVLLLDFSKAFDSVPH 182 Score = 35.5 bits (78), Expect = 0.035 Identities = 18/49 (36%), Positives = 28/49 (57%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 QRL+ KL G+ ++ ++ ++SNR V GT S + V +GVPQ Sbjct: 183 QRLLIKLDFYGIRGNMLNWVKAFVSNRKQSVSVNGTVSSSKSVVSGVPQ 231 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI S +++L LFADD +Y Sbjct: 243 FINDISTSIQSNLRLFADDCVLY 265 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 46.4 bits (105), Expect = 2e-05 Identities = 30/84 (35%), Positives = 39/84 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E +S++ ILI++Q GFR + SC Q+ + Sbjct: 676 YRPISLTSICCKIMEHIILSHMAKHLSSHNILINQQHGFREKFSCETQLISAIHDWAKTI 735 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N R T L D +KAFD V H Sbjct: 736 NFRG--QTDVLLLDFSKAFDSVPH 757 >SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 801 Score = 46.4 bits (105), Expect = 2e-05 Identities = 30/84 (35%), Positives = 39/84 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E +S++ ILI++Q GFR + SC Q+ + Sbjct: 402 YRPISLTSICCKIMEHIILSHMAKHLSSHNILINQQHGFREKFSCETQLISAIHDWAKTI 461 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N R T L D +KAFD V H Sbjct: 462 NFRG--QTDVLLLDFSKAFDSVPH 483 Score = 35.9 bits (79), Expect = 0.026 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 QRL+ KL G+ ++ I+ ++SNR V GT S + V +GVPQ Sbjct: 484 QRLLIKLDFYGIRGNMLNWIKAFVSNRKQSVSVNGTVSSSKSVVSGVPQ 532 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI S +++L LFADD +Y Sbjct: 544 FINDISTSIQSNLRLFADDCVLY 566 >SB_10781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 46.4 bits (105), Expect = 2e-05 Identities = 30/84 (35%), Positives = 39/84 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E +S++ ILI++Q GFR + SC Q+ + Sbjct: 199 YRPISLTSICCKIMEHIILSHMAKHLSSHNILINQQHGFREKFSCETQLISAIHDWAKTI 258 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N R T L D +KAFD V H Sbjct: 259 NFRG--QTDVLLLDFSKAFDSVPH 280 Score = 34.3 bits (75), Expect = 0.080 Identities = 18/49 (36%), Positives = 28/49 (57%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 Q+L+ KL G+ ++ I+ ++SNR V GT S + V +GVPQ Sbjct: 281 QQLLIKLDFYGIRGNMLNWIKAFVSNRKQSVSVNGTVSSSKSVVSGVPQ 329 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI S +++L LFADD +Y Sbjct: 341 FINDISTSIQSNLRLFADDCVLY 363 >SB_53427| Best HMM Match : RVT_1 (HMM E-Value=0.031) Length = 969 Score = 46.0 bits (104), Expect = 2e-05 Identities = 29/84 (34%), Positives = 40/84 (47%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + +N IL+ Q GFR ++SC Q+ +T L Sbjct: 733 YRPISLTSITCKIMEHILFRHLMSHLDSNNILLHIQHGFRKKYSCETQL--ITVLHKLCY 790 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + T + D +KAFD+V H Sbjct: 791 NLDQGNQTDCILLDFSKAFDRVAH 814 >SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 46.0 bits (104), Expect = 2e-05 Identities = 27/84 (32%), Positives = 39/84 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + +N IL+ Q GFR ++SC Q+ + L Sbjct: 104 YRPISLTSITCKIMEHILFRHLMSHLDSNNILLHIQHGFRKKYSCETQLITVLHELCYNL 163 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 ++ T + D +KAFD+V H Sbjct: 164 DQGN--QTDCILLDFSKAFDRVAH 185 Score = 34.3 bits (75), Expect = 0.080 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQAPP-SPRYYSVC 79 RL+ KL G+ + + +R +L +R+ VEG S+ VT+GVPQ P + + Sbjct: 187 RLLQKLDFYGIRGKPLTWVRSWLIHRNQTVVVEGETSKSTRVTSGVPQGTVLGPLMFLLF 246 Query: 78 ISMIYPGL 55 I+ I G+ Sbjct: 247 INDINSGI 254 >SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 907 Score = 46.0 bits (104), Expect = 2e-05 Identities = 27/84 (32%), Positives = 39/84 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + +N IL+ Q GFR ++SC Q+ + L Sbjct: 589 YRPISLTSITCKIMEHILFRHLMSHLDSNNILLHIQHGFRKKYSCETQLITVLHELCYSL 648 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 ++ T + D +KAFD+V H Sbjct: 649 DQGN--QTDCILLDFSKAFDRVAH 670 Score = 34.3 bits (75), Expect = 0.080 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQAPP-SPRYYSVC 79 RL+ KL G+ + + +R +L +R+ VEG S+ VT+GVPQ P + + Sbjct: 672 RLLQKLDFYGIRGKPLTWVRSWLIHRNQTVVVEGETSKSTRVTSGVPQGTVLGPLMFLLF 731 Query: 78 ISMIYPGL 55 I+ I G+ Sbjct: 732 INDINSGI 739 >SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 885 Score = 46.0 bits (104), Expect = 2e-05 Identities = 31/85 (36%), Positives = 39/85 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + + IL Q GFR SC Q+ + +LG Sbjct: 455 YRPISLTCICSKLLEHIITKNIVSHLEHHDILYKFQHGFRKLRSCESQLIEFV-NDILGN 513 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 +R K T + D +KAFDKV HN Sbjct: 514 SRAK--QTDVIIMDFSKAFDKVPHN 536 Score = 31.9 bits (69), Expect = 0.43 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RL+YKL G+ +++ I +L +R V+G +S V +GVPQ Sbjct: 14 RLLYKLERCGIRGDVLMWIGSFLKHRQQSVVVDGEQSDFTPVLSGVPQ 61 Score = 31.9 bits (69), Expect = 0.43 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RL+YKL G+ +++ I +L +R V+G +S V +GVPQ Sbjct: 537 RLLYKLERCGIRGDVLMWIGSFLKHRQQSVVVDGEQSDFTPVLSGVPQ 584 Score = 31.1 bits (67), Expect = 0.75 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YIND+P + + LFADDT IY Sbjct: 73 YINDLPDDIRSTVRLFADDTIIY 95 Score = 31.1 bits (67), Expect = 0.75 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YIND+P + + LFADDT IY Sbjct: 596 YINDLPDDIRSTVRLFADDTIIY 618 >SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1230 Score = 46.0 bits (104), Expect = 2e-05 Identities = 27/84 (32%), Positives = 39/84 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + +N IL+ Q GFR ++SC Q+ + L Sbjct: 958 YRPISLTSITCKIMEHILFRHLMSHLDSNNILLHIQHGFRKKYSCETQLITVLHELCYNL 1017 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 ++ T + D +KAFD+V H Sbjct: 1018 DQGN--QTDCILLDFSKAFDRVAH 1039 Score = 34.3 bits (75), Expect = 0.080 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQAPP-SPRYYSVC 79 RL+ KL G+ + + +R +L +R+ VEG S+ VT+GVPQ P + + Sbjct: 1041 RLLQKLDFYGIRGKPLTWVRSWLIHRNQTVVVEGETSKSTRVTSGVPQGTVLGPLMFLLF 1100 Query: 78 ISMIYPGL 55 I+ I G+ Sbjct: 1101 INDINSGI 1108 >SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 46.0 bits (104), Expect = 2e-05 Identities = 31/85 (36%), Positives = 38/85 (44%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + N IL D Q GFR+ SC Q+ T L Sbjct: 120 YRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDLQHGFRSGFSCETQLVLTTYDWATSL 179 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + + AL +KAFDKV H+ Sbjct: 180 NNQGQV--DALLLHFSKAFDKVSHS 202 Score = 35.5 bits (78), Expect = 0.035 Identities = 22/62 (35%), Positives = 32/62 (51%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL +S+ +L+YKL + G+ + I +LS R+ V GT S VT+GV Sbjct: 189 LLHFSKAFDKVSHSKLLYKLRSYGICGKTCQWITSFLSVRTQFVSVNGTHSSCTPVTSGV 248 Query: 117 PQ 112 PQ Sbjct: 249 PQ 250 Score = 32.7 bits (71), Expect = 0.25 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI +HL LFADDT +Y Sbjct: 262 FINDITLCTRSHLRLFADDTVVY 284 >SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 45.6 bits (103), Expect = 3e-05 Identities = 32/84 (38%), Positives = 38/84 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E +SA IL D Q GFR+ SC Q+ T L Sbjct: 124 YRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFSCETQLILATHDWASTL 183 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + A+ D +KAFDKV H Sbjct: 184 NSHGQV--DAIMLDFSKAFDKVSH 205 >SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 931 Score = 45.6 bits (103), Expect = 3e-05 Identities = 32/84 (38%), Positives = 38/84 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E +SA IL D Q GFR+ SC Q+ T L Sbjct: 465 YRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFSCETQLILATHDWASTL 524 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + A+ D +KAFDKV H Sbjct: 525 NSHGQV--DAIMLDFSKAFDKVSH 546 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +L +KL++ G+ + + I +L+NR+ V+G+ S VT+GVPQ Sbjct: 548 KLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSGVPQ 595 >SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2124 Score = 45.6 bits (103), Expect = 3e-05 Identities = 32/84 (38%), Positives = 38/84 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E +SA IL D Q GFR+ SC Q+ T L Sbjct: 1855 YRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFSCETQLILATHDWASTL 1914 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + A+ D +KAFDKV H Sbjct: 1915 NSHGQV--DAIMLDFSKAFDKVSH 1936 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +L +KL++ G+ + + I +L+NR+ V+G+ S VT+GVPQ Sbjct: 1938 KLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSGVPQ 1985 >SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 45.6 bits (103), Expect = 3e-05 Identities = 32/84 (38%), Positives = 38/84 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E +SA IL D Q GFR+ SC Q+ T L Sbjct: 65 YRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFSCETQLILATHDWASTL 124 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + A+ D +KAFDKV H Sbjct: 125 NSHGQV--DAIMLDFSKAFDKVSH 146 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +L +KL++ G+ + + I +L+NR+ V+G+ S VT+GVPQ Sbjct: 148 KLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSGVPQ 195 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 45.6 bits (103), Expect = 3e-05 Identities = 32/84 (38%), Positives = 38/84 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E +SA IL D Q GFR+ SC Q+ T L Sbjct: 204 YRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFSCETQLILATHDWASTL 263 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + A+ D +KAFDKV H Sbjct: 264 NSHGQV--DAIMLDFSKAFDKVSH 285 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +L +KL++ G+ + + I +L+NR+ V+G+ S VT+GVPQ Sbjct: 287 KLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSGVPQ 334 >SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 810 Score = 45.2 bits (102), Expect = 4e-05 Identities = 31/85 (36%), Positives = 39/85 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + + AN +L Q+G R RH C Q+ L + L L Sbjct: 569 YRPISLTCLSCKLLEHIVASHVMNHLEANGLLSPFQYGSRERHFCETQL--LLTYNDLAL 626 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 K T L D +KAFD V H+ Sbjct: 627 AMDKKQQTDLLLLDFSKAFDSVSHS 651 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/61 (34%), Positives = 33/61 (54%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL +S+ RL+ KL + G+ ++ + D+L NR+ V+G S P VT+GV Sbjct: 638 LLDFSKAFDSVSHSRLLIKLQHYGISGQVYYWLEDFLKNRTQSVVVDGEHSSPAIVTSGV 697 Query: 117 P 115 P Sbjct: 698 P 698 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YIND+P + LFADD A+Y Sbjct: 711 YINDLPDGINGKIRLFADDCALY 733 >SB_49613| Best HMM Match : Transposase_5 (HMM E-Value=0.033) Length = 999 Score = 45.2 bits (102), Expect = 4e-05 Identities = 21/44 (47%), Positives = 25/44 (56%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHS 378 YRPIS+LP I K E D++ N IL D +FGFR HS Sbjct: 19 YRPISILPVISKLMENIMFEQLYDYLIKNNILSDHRFGFRKLHS 62 >SB_28047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 962 Score = 45.2 bits (102), Expect = 4e-05 Identities = 33/124 (26%), Positives = 52/124 (41%), Gaps = 2/124 (1%) Frame = -3 Query: 617 HXIKCCYDELHFSRGVXRSGXXRXTXAGXTEERNXXYRPISLLPAIGKXYEXXXXXXXXD 438 H + C + +F + R ++RN RPIS+LP + K YE D Sbjct: 601 HILNTCISQEYFPSACKVARISRIPKQADVKDRNDL-RPISILPVLSKVYERLVLGQMSD 659 Query: 437 FVSA--NKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKV 264 FVS+ + L D +R HS + + + + R + T + D +KAFD V Sbjct: 660 FVSSGPDSFLKDTVSAYRKGHSTTTSLLAIKDDITKAMKRGE--VTLVVLADFSKAFDTV 717 Query: 263 WHNV 252 + V Sbjct: 718 AYEV 721 >SB_18971| Best HMM Match : PWP2 (HMM E-Value=4) Length = 400 Score = 45.2 bits (102), Expect = 4e-05 Identities = 26/86 (30%), Positives = 43/86 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS L A + +E ++ ++IL + QFGFR HS + + ++ + Sbjct: 311 YRPISTLSA--QVFEKLVCKQLVAYLEKHQILYEFQFGFRKNHSSAQAIAEIADNLRKAI 368 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + + T +F D +KAFD V H + Sbjct: 369 DNNQ--YTCGVFLDFSKAFDTVNHEI 392 >SB_59377| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7) Length = 839 Score = 44.8 bits (101), Expect = 6e-05 Identities = 34/124 (27%), Positives = 53/124 (42%), Gaps = 2/124 (1%) Frame = -3 Query: 617 HXIKCCYDELHFSRGVXRSGXXRXTXAGXTEERNXXYRPISLLPAIGKXYEXXXXXXXXD 438 H + C + +F + ++RN RPIS+LP + K YE D Sbjct: 646 HILNTCISQEYFPSAWKVARISPIPKQADVKDRNDL-RPISILPVLSKVYERLVLGQMSD 704 Query: 437 FVSA--NKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKV 264 FVS+ + IL D +R HS + + + + R + T A+ D +KAFD V Sbjct: 705 FVSSGPDSILKDTVSAYRKGHSTTTSLLAIKDDITKAMKRGE--VTLAVLADFSKAFDTV 762 Query: 263 WHNV 252 + V Sbjct: 763 AYEV 766 >SB_35561| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00092) Length = 813 Score = 44.8 bits (101), Expect = 6e-05 Identities = 34/124 (27%), Positives = 53/124 (42%), Gaps = 2/124 (1%) Frame = -3 Query: 617 HXIKCCYDELHFSRGVXRSGXXRXTXAGXTEERNXXYRPISLLPAIGKXYEXXXXXXXXD 438 H + C + +F + ++RN RPIS+LP + K YE D Sbjct: 620 HILNTCISQEYFPSAWKVARISPIPKQADVKDRNDL-RPISILPVLSKVYERLVLGQMSD 678 Query: 437 FVSA--NKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKV 264 FVS+ + IL D +R HS + + + + R + T A+ D +KAFD V Sbjct: 679 FVSSGPDSILKDTVSAYRKGHSTTTSLLAIKDDITKAMKRGE--VTLAVLADFSKAFDTV 736 Query: 263 WHNV 252 + V Sbjct: 737 AYEV 740 >SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 822 Score = 44.8 bits (101), Expect = 6e-05 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRP+SL K E + + IL D Q GFR R +C Q+ +T H L+ Sbjct: 712 YRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFRKRRNCETQL-IITYHDLVSA 770 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 +N+ K + A D +KAFD+V H Sbjct: 771 INQGKRV--DAFILDFSKAFDRVPH 793 >SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7) Length = 547 Score = 44.8 bits (101), Expect = 6e-05 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRP+SL K E + + IL D Q GFR R +C Q+ +T H L+ Sbjct: 452 YRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFRKRRNCETQL-IITYHDLVSA 510 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 +N+ K + A D +KAFD+V H Sbjct: 511 INQGKRV--DAFILDFSKAFDRVPH 533 >SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1126 Score = 44.8 bits (101), Expect = 6e-05 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRP+SL K E + + IL D Q GFR R +C Q+ +T H L+ Sbjct: 694 YRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFRKRRNCETQL-MITCHDLVSA 752 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 +N+ K + A D +KAFD+V H Sbjct: 753 INQGKRV--DAFILDFSKAFDRVPH 775 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +RL+YKL G+ L+ + D+L+ RS +EG S VT+GVPQ Sbjct: 776 RRLLYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATSSQCSVTSGVPQ 824 >SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) Length = 435 Score = 44.8 bits (101), Expect = 6e-05 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRP+SL K E + + IL D Q GFR R +C Q+ +T H L+ Sbjct: 133 YRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFRKRRNCETQL-IITYHDLVSA 191 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 +N+ K + A D +KAFD+V H Sbjct: 192 INQGKRV--DAFILDFSKAFDRVPH 214 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +RL+YKL G+ L+ + D+L+ RS +EG S VT+GVPQ Sbjct: 215 RRLLYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATSSQCSVTSGVPQ 263 >SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) Length = 382 Score = 44.8 bits (101), Expect = 6e-05 Identities = 24/63 (38%), Positives = 37/63 (58%) Frame = -3 Query: 440 DFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVW 261 D +AN+IL ++QFGFR HS V + T + ++R+K +F D+ KAFD V Sbjct: 7 DHFTANQILSEQQFGFRRLHSTVSALLDSTNSWYINMDRQK--FNLVVFLDLKKAFDTVN 64 Query: 260 HNV 252 H++ Sbjct: 65 HDI 67 Score = 37.1 bits (82), Expect = 0.011 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+ KL G+ +L+I+ YLSNR + ++ T S +T G+PQ Sbjct: 68 LLRKLELNGITGNALLLIQSYLSNRKQKCQINSTVSSESKITCGIPQ 114 >SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 913 Score = 44.8 bits (101), Expect = 6e-05 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRP+SL K E + + IL D Q GFR R +C Q+ +T H L+ Sbjct: 691 YRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFRKRRNCETQL-IITYHDLVSA 749 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 +N+ K + A D +KAFD+V H Sbjct: 750 INQGKRV--DAFILDFSKAFDRVPH 772 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +RL+YKL G+ L+ + D+L+ RS +EG S VT+GVPQ Sbjct: 773 RRLLYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATSSQCSVTSGVPQ 821 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 44.4 bits (100), Expect = 8e-05 Identities = 32/84 (38%), Positives = 38/84 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E +SA IL D Q GFR+ SC Q+ T L Sbjct: 1191 YRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFSCETQLILATHDWGSTL 1250 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + A+ D +KAFDKV H Sbjct: 1251 NSHGQV--DAIMLDFSKAFDKVSH 1272 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +L +KL++ G+ + + I +L+NR+ V+G+ S VT+GVPQ Sbjct: 1274 KLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSGVPQ 1321 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 44.4 bits (100), Expect = 8e-05 Identities = 32/84 (38%), Positives = 38/84 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E +SA IL D Q GFR+ SC Q+ T L Sbjct: 175 YRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFSCETQLILATHDWGSTL 234 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + A+ D +KAFDKV H Sbjct: 235 NSHGQV--DAIMLDFSKAFDKVSH 256 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +L +KL++ G+ + + I +L+NR+ V+G+ S VT+GVPQ Sbjct: 258 KLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSGVPQ 305 >SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 44.4 bits (100), Expect = 8e-05 Identities = 32/84 (38%), Positives = 38/84 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E +SA IL D Q GFR+ SC Q+ T L Sbjct: 143 YRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFSCETQLILATHDWGSTL 202 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + A+ D +KAFDKV H Sbjct: 203 NSHGQV--DAIMLDFSKAFDKVSH 224 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +L +KL++ G+ + + I +L+NR+ V+G+ S VT+GVPQ Sbjct: 226 KLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSGVPQ 273 >SB_6188| Best HMM Match : Transposase_23 (HMM E-Value=0.41) Length = 531 Score = 44.4 bits (100), Expect = 8e-05 Identities = 26/84 (30%), Positives = 39/84 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + +N IL+ + GFR ++SC Q+ + L Sbjct: 387 YRPISLTSITCKIMEHILFRHLMSHLDSNNILLHIKHGFRKKYSCETQLITVLHELCYNL 446 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 ++ T + D +KAFD+V H Sbjct: 447 DQGN--QTDCILLDFSKAFDRVAH 468 Score = 33.9 bits (74), Expect = 0.11 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RL+ KL G+ + + +R +L +R+ VEG S+ VT+GVPQ Sbjct: 470 RLLQKLDFYGIRGKPLTWVRSWLIHRNQTVVVEGETSKSTRVTSGVPQ 517 >SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) Length = 565 Score = 44.0 bits (99), Expect = 1e-04 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRP+SL K E + + IL D Q GFR R +C Q+ +T H L+ Sbjct: 133 YRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFRKRRNCETQL-IITCHDLVSA 191 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 +N+ K + A D +KAFD+V H Sbjct: 192 INQGKRV--DAFILDFSKAFDRVPH 214 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +RL+YKL G+ L+ + D+L+ RS +EG S VT+GVPQ Sbjct: 215 RRLLYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATSSQCSVTSGVPQ 263 >SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 670 Score = 44.0 bits (99), Expect = 1e-04 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRP+SL K E + + IL D Q GFR R +C Q+ +T H L+ Sbjct: 133 YRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFRKRRNCETQL-IITCHDLVSA 191 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 +N+ K + A D +KAFD+V H Sbjct: 192 INQGKRV--DAFILDFSKAFDRVPH 214 Score = 37.1 bits (82), Expect = 0.011 Identities = 19/49 (38%), Positives = 29/49 (59%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 ++L+YKL G+ L+ + D+L+ RS +EG S VT+GVPQ Sbjct: 215 RQLLYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATSSQCSVTSGVPQ 263 >SB_41513| Best HMM Match : RVT_1 (HMM E-Value=8.9e-21) Length = 1080 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RLI KL G+ R + I+ +L+NR+ R V+G S+P VT+GVPQ Sbjct: 597 RLISKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQ 644 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIYY 8 +IND+ + E L LFADD +Y+ Sbjct: 656 FINDMQENLECTLRLFADDALLYH 679 >SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08) Length = 993 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/47 (44%), Positives = 25/47 (53%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVH 369 YRPIS+LP I K E D + N IL + QFGFR HS + Sbjct: 885 YRPISILPVISKLMENIMFEQLYDHLIKNNILSEHQFGFRKLHSTTY 931 >SB_27128| Best HMM Match : PADR1 (HMM E-Value=8.3) Length = 242 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RLI KL G+ R + I+ +L+NR+ R V+G S+P VT+GVPQ Sbjct: 17 RLISKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQ 64 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIYY 8 +IND+ + E L LFADD +Y+ Sbjct: 76 FINDMQENLECTLRLFADDALLYH 99 >SB_20189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 44.0 bits (99), Expect = 1e-04 Identities = 26/86 (30%), Positives = 41/86 (47%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E +++++++ Q GFR HSC + L + L Sbjct: 315 YRPISILPILSKILERHVHVQLYAVLNSHQLITHRQSGFRPYHSCETAMIELFDTLL--K 372 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 N + G D KAFD V +++ Sbjct: 373 NMDNGLINGLALIDYRKAFDLVDYDI 398 >SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 668 Score = 44.0 bits (99), Expect = 1e-04 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRP+SL K E + + IL D Q GFR R +C Q+ +T H L+ Sbjct: 236 YRPVSLTSVTCKILEHIICHHVWQHLEQHGILSDFQHGFRKRRNCETQL-IITCHDLVSA 294 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 +N+ K + A D +KAFD+V H Sbjct: 295 INQGKRV--DAFILDFSKAFDRVPH 317 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +RL+YKL G+ L+ + D+L+ RS +EG S VT+GVPQ Sbjct: 318 RRLLYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATSSQCSVTSGVPQ 366 >SB_7615| Best HMM Match : RVT_1 (HMM E-Value=1e-33) Length = 363 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RLI KL G+ R + I+ +L+NR+ R V+G S+P VT+GVPQ Sbjct: 138 RLISKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQ 185 Score = 40.3 bits (90), Expect = 0.001 Identities = 36/112 (32%), Positives = 48/112 (42%), Gaps = 3/112 (2%) Frame = -3 Query: 425 NKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVWHNV*Y 246 N IL Q GFR HSC Q+ E L N L D +KAFDKV H Sbjct: 83 NNILFANQHGFRKNHSCETQLLLTVED--LARNTDNGGQIDMLILDFSKAFDKVAHGRLI 140 Query: 245 TNCITWECQTGSCSSYET--TCRTVRSDIESRERVPGPVTS-QPESRKLRPL 99 + + + Q + + ++ T RT R ++ P VTS P+ L PL Sbjct: 141 SKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPL 192 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIYY 8 +IND+ + E L LFADD +Y+ Sbjct: 197 FINDMQENLECTLRLFADDALLYH 220 >SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) Length = 1445 Score = 44.0 bits (99), Expect = 1e-04 Identities = 26/86 (30%), Positives = 41/86 (47%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LP + K E +++++++ Q GFR HSC + L + L Sbjct: 329 YRPISILPILSKILERHVHVQLYAVLNSHQLITHRQSGFRPYHSCETAMIELFDTLL--K 386 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 N + G D KAFD V +++ Sbjct: 387 NMDNGLINGLALIDYRKAFDLVDYDI 412 >SB_48371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 811 Score = 44.0 bits (99), Expect = 1e-04 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRP+SL K E + + IL D Q GFR R +C Q+ +T H L+ Sbjct: 236 YRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFRKRRNCETQL-IITCHDLVSA 294 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 +N+ K + A D +KAFD+V H Sbjct: 295 INQGKRV--DAFILDFSKAFDRVPH 317 >SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) Length = 900 Score = 44.0 bits (99), Expect = 1e-04 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRP+SL K E + + IL D Q GFR R +C Q+ +T H L+ Sbjct: 468 YRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFRKRRNCETQL-IITCHDLVSA 526 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 +N+ K + A D +KAFD+V H Sbjct: 527 INQGKRV--DAFILDFSKAFDRVPH 549 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +RL+YKL G+ L+ + D+L+ RS +EG S VT+GVPQ Sbjct: 550 RRLLYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATSSQCSVTSGVPQ 598 >SB_25914| Best HMM Match : IL1_propep (HMM E-Value=8.1) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/47 (44%), Positives = 25/47 (53%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVH 369 YRPIS+LP I K E D + N IL + QFGFR HS + Sbjct: 23 YRPISILPVISKLMENIMFEQLYDHLIKNNILSEHQFGFRKLHSTTY 69 >SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4700 Score = 44.0 bits (99), Expect = 1e-04 Identities = 26/85 (30%), Positives = 41/85 (48%) Frame = -3 Query: 506 RPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGLN 327 RPIS+LP + K E F+ +++++ Q GFR HSC + L + L ++ Sbjct: 393 RPISILPILSKILERHFHVQLYAFLYSHQLITHRQSGFRPYHSCETAMIELVDTLLKNMD 452 Query: 326 RRKPIPTGALFFDIAKAFDKVWHNV 252 I G D KAFD V +++ Sbjct: 453 NNGLI-NGLALNDDRKAFDLVGYDI 476 >SB_4888| Best HMM Match : DUF104 (HMM E-Value=7.3) Length = 242 Score = 44.0 bits (99), Expect = 1e-04 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRP+SL K E + + IL D Q GFR R +C Q+ +T H L+ Sbjct: 133 YRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFRKRRNCETQL-IITCHDLVSA 191 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 +N+ K + A D +KAFD+V H Sbjct: 192 INQGKRV--DAFILDFSKAFDRVPH 214 >SB_1851| Best HMM Match : RVT_1 (HMM E-Value=3.2e-16) Length = 287 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RLI KL G+ R + I+ +L+NR+ R V+G S+P VT+GVPQ Sbjct: 62 RLISKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQ 109 Score = 40.3 bits (90), Expect = 0.001 Identities = 36/112 (32%), Positives = 48/112 (42%), Gaps = 3/112 (2%) Frame = -3 Query: 425 NKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVWHNV*Y 246 N IL Q GFR HSC Q+ E L N L D +KAFDKV H Sbjct: 7 NNILFANQHGFRKNHSCETQLLLTVED--LARNTDNGGQIDMLILDFSKAFDKVAHGRLI 64 Query: 245 TNCITWECQTGSCSSYET--TCRTVRSDIESRERVPGPVTS-QPESRKLRPL 99 + + + Q + + ++ T RT R ++ P VTS P+ L PL Sbjct: 65 SKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSGVPQGTVLGPL 116 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIYY 8 +IND+ + E L LFADD +Y+ Sbjct: 121 FINDMQENLECTLRLFADDALLYH 144 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 43.6 bits (98), Expect = 1e-04 Identities = 29/84 (34%), Positives = 37/84 (44%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPI+L K E + + IL D Q GFR SC Q+ + GL Sbjct: 241 YRPIALTSVTCKVMEHIVYHHIYAHLDRHHILRDFQHGFRKGRSCETQLIITVDDIARGL 300 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + R + L D +KAFDKV H Sbjct: 301 DNRSQV--DLLILDFSKAFDKVPH 322 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RL+ KL ++GV I +L+ R + ++G S P +GVPQ Sbjct: 324 RLLAKLDHLGVEGNTHGWIATWLTKRYQQVTLDGASSAPVKTRSGVPQ 371 >SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 411 Score = 43.6 bits (98), Expect = 1e-04 Identities = 31/82 (37%), Positives = 37/82 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E +SA IL D Q GFR+ SC Q+ T L Sbjct: 73 YRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFSCETQLILATHDWASTL 132 Query: 329 NRRKPIPTGALFFDIAKAFDKV 264 N + A+ D +KAFDKV Sbjct: 133 NSHGQV--DAIMLDFSKAFDKV 152 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +L +KL++ G+ + + I +L+NR+ V+G+ S VT+GVPQ Sbjct: 156 KLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSGVPQ 203 >SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2123 Score = 43.6 bits (98), Expect = 1e-04 Identities = 30/85 (35%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRP+SL K E + + IL D Q GFR R +C Q+ +T H L+ Sbjct: 1859 YRPVSLTSVTCKILEHVICHHVWKHLEQHGILSDFQHGFRKRRNCETQL-IITCHDLVSA 1917 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 +N+ K + A D +KAFD+V H Sbjct: 1918 INQGKRV--DAFILDFSKAFDRVPH 1940 >SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 43.6 bits (98), Expect = 1e-04 Identities = 29/84 (34%), Positives = 37/84 (44%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPI+L K E + + IL D Q GFR SC Q+ + GL Sbjct: 309 YRPIALTSVTCKVMEHIVYHYIYAHLDRHHILRDFQHGFRKGRSCETQLIITVDDIARGL 368 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + R + L D +KAFDKV H Sbjct: 369 DNRSQV--DLLILDFSKAFDKVPH 390 Score = 28.7 bits (61), Expect = 4.0 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RL+ KL ++GV I +L+ R + ++G S P + +GVPQ Sbjct: 392 RLLAKLDHLGVEGNTHGWIATWLTKRYQQVTLDGASSTPVNTRSGVPQ 439 >SB_45005| Best HMM Match : RVT_1 (HMM E-Value=6.6e-32) Length = 871 Score = 43.2 bits (97), Expect = 2e-04 Identities = 22/79 (27%), Positives = 38/79 (48%) Frame = -3 Query: 488 PAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIP 309 P + K +E D++S N ++ Q GFR+ HS V + + T+ +++ Sbjct: 448 PIVAKIFERTVYEQFYDYLSENHLISSFQSGFRSLHSTVTALLKATDDWAFNIDKGNV-- 505 Query: 308 TGALFFDIAKAFDKVWHNV 252 +F D+ KAFD V H + Sbjct: 506 NAVVFLDLKKAFDTVDHGI 524 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+ KL G+ + YL NR+ R V + S P+ +T G+PQ Sbjct: 525 LLSKLNFYGISGIAHEWFKSYLLNRTQRCSVNNSLSGPKFLTCGIPQ 571 >SB_17732| Best HMM Match : RVT_1 (HMM E-Value=1.5e-27) Length = 399 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/75 (32%), Positives = 38/75 (50%) Frame = -3 Query: 476 KXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGAL 297 K +E +F+ N IL D Q+GFR HS + +L + ++ R+ T + Sbjct: 68 KFFEKVVYKRLYNFLLKNNILFDNQYGFRKHHSTALALLQLYDKLSAAIDNRE--YTIGV 125 Query: 296 FFDIAKAFDKVWHNV 252 F D++KAFD V H + Sbjct: 126 FIDLSKAFDTVNHYI 140 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 42.7 bits (96), Expect = 2e-04 Identities = 33/85 (38%), Positives = 39/85 (45%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRPISL K E + IL D Q GFRA+ S V Q+ LT H + Sbjct: 640 YRPISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQL-ILTIHDMAKA 698 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 + K I L D +KAFDKV H Sbjct: 699 IQENKSIHAAVL--DFSKAFDKVPH 721 Score = 36.7 bits (81), Expect = 0.015 Identities = 24/70 (34%), Positives = 35/70 (50%) Frame = -2 Query: 321 ETHSDRSPLLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSR 142 E S + +L +S+ +RLI KL G+ L+ +L NR+ +G RS Sbjct: 701 ENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHGPLLYWFMSFLRNRTQTVVCDGKRSC 760 Query: 141 PRHVTAGVPQ 112 P VT+GVPQ Sbjct: 761 PSLVTSGVPQ 770 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 Y+ND+P + ++ + LFADD +Y Sbjct: 782 YVNDLPDNLKSSIRLFADDALLY 804 >SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04) Length = 197 Score = 42.7 bits (96), Expect = 2e-04 Identities = 24/62 (38%), Positives = 34/62 (54%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL YS+ +L+ KLY+ G+ + + I +L NRS V G+ S HVT+GV Sbjct: 34 LLDYSKAFDKVSHSKLLKKLYHYGIEGKTLAWISGFLRNRSQYVVVNGSHSSKVHVTSGV 93 Query: 117 PQ 112 PQ Sbjct: 94 PQ 95 Score = 31.1 bits (67), Expect = 0.75 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YINDI + ++ + LFADDT IY Sbjct: 107 YINDICEASKSQVRLFADDTIIY 129 >SB_13949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 42.7 bits (96), Expect = 2e-04 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQV 363 YRPISL P + +E ++ + IL QFGFR +HS H V Sbjct: 343 YRPISLPPIFNQIFEKLICQRLNHYLQTHNILYSNQFGFRPKHSTTHAV 391 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 42.7 bits (96), Expect = 2e-04 Identities = 33/85 (38%), Positives = 39/85 (45%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRPISL K E + IL D Q GFRA+ S V Q+ LT H + Sbjct: 362 YRPISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQL-ILTIHDMAKA 420 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 + K I L D +KAFDKV H Sbjct: 421 IQENKSIHAAVL--DFSKAFDKVPH 443 Score = 36.7 bits (81), Expect = 0.015 Identities = 24/70 (34%), Positives = 35/70 (50%) Frame = -2 Query: 321 ETHSDRSPLLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSR 142 E S + +L +S+ +RLI KL G+ L+ +L NR+ +G RS Sbjct: 423 ENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHGPLLYWFMSFLRNRTQTVVCDGKRSC 482 Query: 141 PRHVTAGVPQ 112 P VT+GVPQ Sbjct: 483 PSLVTSGVPQ 492 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 Y+ND+P + ++ + LFADD +Y Sbjct: 504 YVNDLPDNLKSSIRLFADDALLY 526 >SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) Length = 863 Score = 42.7 bits (96), Expect = 2e-04 Identities = 33/85 (38%), Positives = 39/85 (45%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRPISL K E + IL D Q GFRA+ S V Q+ LT H + Sbjct: 479 YRPISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQL-ILTIHDMAKA 537 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 + K I L D +KAFDKV H Sbjct: 538 IQENKSIHAAVL--DFSKAFDKVPH 560 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 42.7 bits (96), Expect = 2e-04 Identities = 33/85 (38%), Positives = 39/85 (45%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRPISL K E + IL D Q GFRA+ S V Q+ LT H + Sbjct: 152 YRPISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQL-ILTIHDMAKA 210 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 + K I L D +KAFDKV H Sbjct: 211 IQENKSIHAAVL--DFSKAFDKVPH 233 Score = 36.7 bits (81), Expect = 0.015 Identities = 24/70 (34%), Positives = 35/70 (50%) Frame = -2 Query: 321 ETHSDRSPLLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSR 142 E S + +L +S+ +RLI KL G+ L+ +L NR+ +G RS Sbjct: 213 ENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHGPLLYWFMSFLRNRTQTVVCDGKRSC 272 Query: 141 PRHVTAGVPQ 112 P VT+GVPQ Sbjct: 273 PSLVTSGVPQ 282 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 Y+ND+P + ++ + LFADD +Y Sbjct: 294 YVNDLPDNLKSSIRLFADDALLY 316 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 42.7 bits (96), Expect = 2e-04 Identities = 33/85 (38%), Positives = 39/85 (45%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRPISL K E + IL D Q GFRA+ S V Q+ LT H + Sbjct: 237 YRPISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQL-ILTIHDMAKA 295 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 + K I L D +KAFDKV H Sbjct: 296 IQENKSIHAAVL--DFSKAFDKVPH 318 Score = 36.7 bits (81), Expect = 0.015 Identities = 24/70 (34%), Positives = 35/70 (50%) Frame = -2 Query: 321 ETHSDRSPLLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSR 142 E S + +L +S+ +RLI KL G+ L+ +L NR+ +G RS Sbjct: 298 ENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHGPLLYWFMSFLRNRTQTVVCDGKRSC 357 Query: 141 PRHVTAGVPQ 112 P VT+GVPQ Sbjct: 358 PSLVTSGVPQ 367 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 Y+ND+P + ++ + LFADD +Y Sbjct: 379 YVNDLPDNLKSSIRLFADDALLY 401 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 42.7 bits (96), Expect = 2e-04 Identities = 33/85 (38%), Positives = 39/85 (45%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YRPISL K E + IL D Q GFRA+ S V Q+ LT H + Sbjct: 170 YRPISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQL-ILTIHDMAKA 228 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 + K I L D +KAFDKV H Sbjct: 229 IQENKSIHAAVL--DFSKAFDKVPH 251 Score = 36.7 bits (81), Expect = 0.015 Identities = 24/70 (34%), Positives = 35/70 (50%) Frame = -2 Query: 321 ETHSDRSPLLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSR 142 E S + +L +S+ +RLI KL G+ L+ +L NR+ +G RS Sbjct: 231 ENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHGPLLYWFMSFLRNRTQTVVCDGKRSC 290 Query: 141 PRHVTAGVPQ 112 P VT+GVPQ Sbjct: 291 PSLVTSGVPQ 300 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 Y+ND+P + ++ + LFADD +Y Sbjct: 312 YVNDLPDNLKSSIRLFADDALLY 334 >SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) Length = 816 Score = 42.3 bits (95), Expect = 3e-04 Identities = 25/86 (29%), Positives = 42/86 (48%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YR +S+L I K +E D + + + GF HSC + +LTE L Sbjct: 482 YRLVSVLSTIPKIFERLQFDQLYDAFAM--VFSNNMSGFLRGHSCCSALIKLTEDWRASL 539 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 ++R+ + G + D++KAFD + N+ Sbjct: 540 DKRESV--GVVAIDLSKAFDSICRNL 563 Score = 29.5 bits (63), Expect = 2.3 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 1/84 (1%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQAPPSPRYYSVC-I 76 L+ KL GV + I+ YL+ R R R G S + G+PQ Y S C + Sbjct: 564 LLAKLSAYGVSPAALKTIQSYLTGRIQRVRCNGVMSDWLEIHCGIPQ-EVYWYYASTCPV 622 Query: 75 SMIYPGLRRPIWRSSPMTPPSTTR 4 +M + R W SS +T++ Sbjct: 623 AMEFAMTRINDWFSSDYLGINTSK 646 >SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) Length = 419 Score = 42.3 bits (95), Expect = 3e-04 Identities = 31/85 (36%), Positives = 37/85 (43%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E ++AN IL Q GFR SC Q+ L Sbjct: 237 YRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALSCETQLVLTFHDWATTL 296 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + AL D +KAFDKV H+ Sbjct: 297 NHHGQV--DALLLDYSKAFDKVSHS 319 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/62 (37%), Positives = 33/62 (53%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL YS+ +L+ KL + G+ + + I +L NRS V G+ S HVT+GV Sbjct: 306 LLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWISGFLRNRSQYVIVNGSHSSKVHVTSGV 365 Query: 117 PQ 112 PQ Sbjct: 366 PQ 367 Score = 31.1 bits (67), Expect = 0.75 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YINDI + ++ + LFADDT IY Sbjct: 379 YINDICEASKSQVRLFADDTIIY 401 >SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 42.3 bits (95), Expect = 3e-04 Identities = 31/85 (36%), Positives = 37/85 (43%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E ++AN IL Q GFR SC Q+ L Sbjct: 98 YRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALSCETQLVLTFHDWATTL 157 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + AL D +KAFDKV H+ Sbjct: 158 NHHGQV--DALLLDYSKAFDKVSHS 180 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/62 (37%), Positives = 33/62 (53%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL YS+ +L+ KL + G+ + + I +L NRS V G+ S HVT+GV Sbjct: 167 LLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWISGFLRNRSQYVVVNGSHSSKVHVTSGV 226 Query: 117 PQ 112 PQ Sbjct: 227 PQ 228 Score = 31.1 bits (67), Expect = 0.75 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YINDI + ++ + LFADDT IY Sbjct: 240 YINDICEASKSQVRLFADDTIIY 262 >SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2396 Score = 42.3 bits (95), Expect = 3e-04 Identities = 31/85 (36%), Positives = 37/85 (43%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E ++AN IL Q GFR SC Q+ L Sbjct: 1636 YRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALSCETQLVLTFHDWATTL 1695 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + AL D +KAFDKV H+ Sbjct: 1696 NHHGQV--DALLLDYSKAFDKVSHS 1718 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/62 (37%), Positives = 33/62 (53%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL YS+ +L+ KL + G+ + + I +L NRS V G+ S HVT+GV Sbjct: 1705 LLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWISGFLRNRSQYVVVNGSHSSKVHVTSGV 1764 Query: 117 PQ 112 PQ Sbjct: 1765 PQ 1766 Score = 31.1 bits (67), Expect = 0.75 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YINDI + ++ + LFADDT IY Sbjct: 1778 YINDICEASKSQVRLFADDTIIY 1800 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +IND+P ++ + LFADD+ +Y Sbjct: 1971 FINDMPSGIQSQVKLFADDSVLY 1993 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQA 109 LI KL V + + + YL +R + + G S + TAG+PQ+ Sbjct: 758 LIKKLSVYSVSGKSLNWFKSYLEDRKQKVTISGQLSDSQPFTAGIPQS 805 >SB_576| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1444 Score = 42.3 bits (95), Expect = 3e-04 Identities = 33/124 (26%), Positives = 53/124 (42%), Gaps = 2/124 (1%) Frame = -3 Query: 617 HXIKCCYDELHFSRGVXRSGXXRXTXAGXTEERNXXYRPISLLPAIGKXYEXXXXXXXXD 438 H + C + +F + ++RN RPIS+LP + K YE D Sbjct: 703 HILNTCISQEYFPSAWKVARISPIPKQADVKDRNDL-RPISILPVLSKVYERLVLGQMSD 761 Query: 437 FVSA--NKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKV 264 FVS+ + IL D +R +S + + + + R + T A+ D +KAFD V Sbjct: 762 FVSSGPDSILKDTVSAYRKGYSTTTSLLAIKDDITKAMKRGE--VTLAVLADFSKAFDTV 819 Query: 263 WHNV 252 + V Sbjct: 820 AYKV 823 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 ++ KL+++G ++ + YL+ R +++ SR V GVPQ Sbjct: 824 VLKKLHHLGFSKSFLMWVTSYLTGRKQFVQIDDKSSRLADVCLGVPQ 870 >SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 42.3 bits (95), Expect = 3e-04 Identities = 31/85 (36%), Positives = 37/85 (43%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E ++AN IL Q GFR SC Q+ L Sbjct: 664 YRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALSCETQLVLTFHDWATTL 723 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + AL D +KAFDKV H+ Sbjct: 724 NHHGQV--DALLLDYSKAFDKVSHS 746 Score = 38.7 bits (86), Expect = 0.004 Identities = 22/62 (35%), Positives = 33/62 (53%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL YS+ +L+ KL + G+ + + + +L NRS V G+ S HVT+GV Sbjct: 733 LLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWVSGFLRNRSQYVVVNGSHSSKVHVTSGV 792 Query: 117 PQ 112 PQ Sbjct: 793 PQ 794 Score = 31.1 bits (67), Expect = 0.75 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YINDI + ++ + LFADDT IY Sbjct: 806 YINDICEASKSQVRLFADDTIIY 828 >SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2) Length = 329 Score = 42.3 bits (95), Expect = 3e-04 Identities = 31/85 (36%), Positives = 37/85 (43%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E ++AN IL Q GFR SC Q+ L Sbjct: 219 YRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALSCETQLVLTFHDWATTL 278 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + AL D +KAFDKV H+ Sbjct: 279 NHHGQV--DALLLDYSKAFDKVSHS 301 >SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) Length = 1492 Score = 42.3 bits (95), Expect = 3e-04 Identities = 31/85 (36%), Positives = 37/85 (43%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E ++AN IL Q GFR SC Q+ L Sbjct: 1074 YRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALSCETQLVLTFHDWATTL 1133 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + AL D +KAFDKV H+ Sbjct: 1134 NHHGQV--DALLLDYSKAFDKVSHS 1156 Score = 31.1 bits (67), Expect = 0.75 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YINDI + ++ + LFADDT IY Sbjct: 1199 YINDICEASKSQVRLFADDTIIY 1221 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 42.3 bits (95), Expect = 3e-04 Identities = 31/85 (36%), Positives = 37/85 (43%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E ++AN IL Q GFR SC Q+ L Sbjct: 17 YRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALSCETQLVLTFHDWATTL 76 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + AL D +KAFDKV H+ Sbjct: 77 NHHGQV--DALLLDYSKAFDKVSHS 99 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/62 (37%), Positives = 33/62 (53%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL YS+ +L+ KL + G+ + + I +L NRS V G+ S HVT+GV Sbjct: 86 LLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWISGFLRNRSQYVVVNGSHSSKVHVTSGV 145 Query: 117 PQ 112 PQ Sbjct: 146 PQ 147 Score = 31.1 bits (67), Expect = 0.75 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YINDI + ++ + LFADDT IY Sbjct: 159 YINDICEASKSQVRLFADDTIIY 181 >SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 42.3 bits (95), Expect = 3e-04 Identities = 31/85 (36%), Positives = 37/85 (43%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E ++AN IL Q GFR SC Q+ L Sbjct: 98 YRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALSCETQLVLTFHDWATTL 157 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + AL D +KAFDKV H+ Sbjct: 158 NHHGQV--DALLLDYSKAFDKVSHS 180 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/62 (37%), Positives = 33/62 (53%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL YS+ +L+ KL + G+ + + I +L NRS V G+ S HVT+GV Sbjct: 167 LLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWISGFLRNRSQYVVVNGSHSSKVHVTSGV 226 Query: 117 PQ 112 PQ Sbjct: 227 PQ 228 Score = 31.1 bits (67), Expect = 0.75 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YINDI + ++ + LFADDT IY Sbjct: 240 YINDICEASKSQVRLFADDTIIY 262 >SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 533 Score = 41.9 bits (94), Expect = 4e-04 Identities = 28/85 (32%), Positives = 37/85 (43%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+SL + K E +SAN I+ Q GF SC Q+ + L Sbjct: 161 YRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGFLKGLSCSTQLISVIHDWSSVL 220 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + +F D AKAFD V H+ Sbjct: 221 NDHGQV--DVVFLDFAKAFDSVPHD 243 Score = 35.5 bits (78), Expect = 0.035 Identities = 20/48 (41%), Positives = 27/48 (56%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RL+ K G+ RL+L +R +L+NR R V G S V +GVPQ Sbjct: 244 RLLIKAEFYGIRGRLLLWLRHFLTNRRQRVVVNGASSTWSPVLSGVPQ 291 Score = 32.3 bits (70), Expect = 0.32 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +IND+P ++H+ LFADD+ +Y Sbjct: 303 FINDLPSGIKSHVKLFADDSVLY 325 >SB_36120| Best HMM Match : zf-MIZ (HMM E-Value=3.9) Length = 209 Score = 41.9 bits (94), Expect = 4e-04 Identities = 29/85 (34%), Positives = 38/85 (44%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E ++A+ I+ + Q GFRA SC Q+ L Sbjct: 88 YRPISLTCLACKVMEHVVLSHLNKHLAAHNIISNLQHGFRAGFSCETQLILAVHDWASIL 147 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N+ + L D KAFDKV H+ Sbjct: 148 NKHGQV--DVLLLDFQKAFDKVSHS 170 >SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 522 Score = 41.9 bits (94), Expect = 4e-04 Identities = 29/85 (34%), Positives = 38/85 (44%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E ++A+ I+ + Q GFRA SC Q+ L Sbjct: 88 YRPISLTCLACKVMEHVVLSHLNKHLAAHNIISNLQHGFRAGFSCETQLILAVHDWASIL 147 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N+ + L D KAFDKV H+ Sbjct: 148 NKHGQV--DVLLLDFQKAFDKVSHS 170 Score = 31.1 bits (67), Expect = 0.75 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +L KL G+ + + + +L+NRS V+G +S VT+GVPQ Sbjct: 171 KLQQKLKLYGISGKTLSWLSAFLTNRSQFVAVDGAKSNAVPVTSGVPQ 218 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI S ++ + LFADD +Y Sbjct: 230 FINDIADSLDSQMRLFADDAIVY 252 >SB_15607| Best HMM Match : zf-MIZ (HMM E-Value=3.9) Length = 221 Score = 41.9 bits (94), Expect = 4e-04 Identities = 29/85 (34%), Positives = 38/85 (44%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E ++A+ I+ + Q GFRA SC Q+ L Sbjct: 121 YRPISLTCLACKVMEHVVLSHLNKHLAAHNIISNLQHGFRAGFSCETQLILAVHDWASIL 180 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N+ + L D KAFDKV H+ Sbjct: 181 NKHGQV--DVLLLDFQKAFDKVSHS 203 >SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) Length = 224 Score = 41.9 bits (94), Expect = 4e-04 Identities = 29/85 (34%), Positives = 38/85 (44%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E ++A+ I+ + Q GFRA SC Q+ L Sbjct: 38 YRPISLTCLACKVMEHVVLSHLNKHLAAHNIISNLQHGFRAGFSCETQLILAVHDWASIL 97 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N+ + L D KAFDKV H+ Sbjct: 98 NKHGQV--DVLLLDFQKAFDKVSHS 120 Score = 31.1 bits (67), Expect = 0.75 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +L KL G+ + + + +L+NRS V+G +S VT+GVPQ Sbjct: 121 KLQQKLKLYGISGKTLSWLSAFLTNRSQFVAVDGAKSNAVPVTSGVPQ 168 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI S ++ + LFADD +Y Sbjct: 180 FINDIADSLDSQMRLFADDAIVY 202 >SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1676 Score = 41.9 bits (94), Expect = 4e-04 Identities = 29/85 (34%), Positives = 38/85 (44%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E ++A+ I+ + Q GFRA SC Q+ L Sbjct: 710 YRPISLTCLACKVMEHVVLSHLNKHLAAHNIISNLQHGFRAGFSCETQLILAVHDWASIL 769 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N+ + L D KAFDKV H+ Sbjct: 770 NKHGQV--DVLLLDFQKAFDKVSHS 792 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI S ++ + LFADD +Y Sbjct: 852 FINDIADSLDSQMRLFADDAIVY 874 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVP 115 +L KL G+ + + + L+NRS V+G +S VT+GVP Sbjct: 793 KLQQKLKLYGISGKTLSWLSALLTNRSQFVAVDGAKSNAVPVTSGVP 839 >SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1009 Score = 41.9 bits (94), Expect = 4e-04 Identities = 28/85 (32%), Positives = 37/85 (43%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+SL + K E +SAN I+ Q GF SC Q+ + L Sbjct: 605 YRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGFLKGLSCSTQLISVIHDWSSVL 664 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N + +F D AKAFD V H+ Sbjct: 665 NDHGQVE--VVFLDFAKAFDSVPHD 687 Score = 35.5 bits (78), Expect = 0.035 Identities = 20/48 (41%), Positives = 27/48 (56%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RL+ K G+ RL+L +R +L+NR R V G S V +GVPQ Sbjct: 688 RLLIKAEFYGIRGRLLLWLRHFLTNRRQRVVVNGASSTWSPVLSGVPQ 735 Score = 32.3 bits (70), Expect = 0.32 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +IND+P ++H+ LFADD+ +Y Sbjct: 747 FINDLPSGIKSHVKLFADDSVLY 769 >SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1176 Score = 41.9 bits (94), Expect = 4e-04 Identities = 29/85 (34%), Positives = 38/85 (44%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E ++A+ I+ + Q GFRA SC Q+ L Sbjct: 794 YRPISLTCLACKVMEHVVLSHLNKHLAAHNIISNLQHGFRAGFSCETQLILAVHDWASIL 853 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 N+ + L D KAFDKV H+ Sbjct: 854 NKHGQV--DVLLLDFQKAFDKVSHS 876 Score = 31.1 bits (67), Expect = 0.75 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +L KL G+ + + + +L+NRS V+G +S VT+GVPQ Sbjct: 877 KLQQKLKLYGISGKTLSWLSAFLTNRSQFVAVDGAKSNAVPVTSGVPQ 924 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI S ++ + LFADD +Y Sbjct: 936 FINDIADSLDSQMRLFADDAIVY 958 >SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1025 Score = 41.5 bits (93), Expect = 5e-04 Identities = 28/84 (33%), Positives = 36/84 (42%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+SL + K E +SAN I+ Q GF SC Q+ + L Sbjct: 673 YRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGFLKGLSCSTQLISVIHDWSSVL 732 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + +F D AKAFD V H Sbjct: 733 NDHGQV--DVVFLDFAKAFDSVPH 754 Score = 36.3 bits (80), Expect = 0.020 Identities = 20/49 (40%), Positives = 28/49 (57%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +RL+ K G+ RL+L +R +L+NR R V G S V +GVPQ Sbjct: 755 ERLLIKAEFYGIRGRLLLWLRHFLTNRRQRVVVNGASSTWSPVLSGVPQ 803 Score = 32.3 bits (70), Expect = 0.32 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +IND+P ++H+ LFADD+ +Y Sbjct: 815 FINDLPSGIKSHVKLFADDSVLY 837 >SB_39386| Best HMM Match : RVT_1 (HMM E-Value=7.1e-28) Length = 1239 Score = 41.5 bits (93), Expect = 5e-04 Identities = 30/94 (31%), Positives = 46/94 (48%), Gaps = 2/94 (2%) Frame = -3 Query: 527 EERNXXYRPISLLPAIGKXYEXXXXXXXXDFVSA--NKILIDEQFGFRARHSCVHQVHRL 354 ++RN RPIS+LP + + YE DFVS+ + IL D +R HS + + Sbjct: 441 KDRNDL-RPISILPVLSEVYERLVLGQMSDFVSSGPDSILKDTVSAYRKGHSTTTSLLAI 499 Query: 353 TEHXLLGLNRRKPIPTGALFFDIAKAFDKVWHNV 252 + + R + T A+ D +KAFD V + V Sbjct: 500 KDDITKAMKRGE--VTLAVLADFSKAFDTVAYEV 531 >SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 295 Score = 41.5 bits (93), Expect = 5e-04 Identities = 28/84 (33%), Positives = 36/84 (42%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+SL + K E +SAN I+ Q GF SC Q+ + L Sbjct: 71 YRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGFLKGLSCSTQLISVIHDWSSVL 130 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + +F D AKAFD V H Sbjct: 131 NDHGQV--DVVFLDFAKAFDSVPH 152 Score = 34.7 bits (76), Expect = 0.061 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +RL+ K G+ RL+L +R + +NR R V G S V +GVPQ Sbjct: 153 ERLLIKAEFYGIRGRLLLWLRHFFTNRRQRVVVNGASSTWSPVLSGVPQ 201 Score = 32.3 bits (70), Expect = 0.32 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +IND+P ++H+ LFADD+ +Y Sbjct: 213 FINDLPSGIKSHVKLFADDSVLY 235 >SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) Length = 823 Score = 41.5 bits (93), Expect = 5e-04 Identities = 28/84 (33%), Positives = 36/84 (42%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+SL + K E +SAN I+ Q GF SC Q+ + L Sbjct: 162 YRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGFLKGLSCSTQLISVIHDWSSVL 221 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + +F D AKAFD V H Sbjct: 222 NDHGQV--DVVFLDFAKAFDSVPH 243 Score = 32.3 bits (70), Expect = 0.32 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +IND+P ++H+ LFADD+ +Y Sbjct: 295 FINDLPSGIKSHVKLFADDSVLY 317 >SB_31162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/48 (43%), Positives = 30/48 (62%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RLI KL G+ R + I+ +L+NR+ R V+G +P VT+GVPQ Sbjct: 76 RLISKLLYYGIQGRTLAWIKSWLTNRTERVVVDGVSLKPVDVTSGVPQ 123 Score = 40.3 bits (90), Expect = 0.001 Identities = 36/112 (32%), Positives = 48/112 (42%), Gaps = 3/112 (2%) Frame = -3 Query: 425 NKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVWHNV*Y 246 N IL Q GFR HSC Q+ E L N L D +KAFDKV H Sbjct: 21 NNILFANQHGFRKNHSCETQLLLTVED--LARNTDNGGQIDMLILDFSKAFDKVAHGRLI 78 Query: 245 TNCITWECQTGSCSSYET--TCRTVRSDIESRERVPGPVTS-QPESRKLRPL 99 + + + Q + + ++ T RT R ++ P VTS P+ L PL Sbjct: 79 SKLLYYGIQGRTLAWIKSWLTNRTERVVVDGVSLKPVDVTSGVPQGTALGPL 130 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIYY 8 +IND+ + E L LFADD +Y+ Sbjct: 135 FINDMQENLECTLRLFADDALLYH 158 >SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) Length = 275 Score = 41.5 bits (93), Expect = 5e-04 Identities = 28/84 (33%), Positives = 36/84 (42%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+SL + K E +SAN I+ Q GF SC Q+ + L Sbjct: 70 YRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGFLKGLSCSTQLISVIHDWSSVL 129 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + +F D AKAFD V H Sbjct: 130 NDHGQV--DVVFLDFAKAFDSVPH 151 Score = 36.3 bits (80), Expect = 0.020 Identities = 20/49 (40%), Positives = 28/49 (57%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +RL+ K G+ RL+L +R +L+NR R V G S V +GVPQ Sbjct: 152 ERLLIKAEFYGIRGRLLLWLRHFLTNRRQRVVVNGASSTWSPVLSGVPQ 200 Score = 32.3 bits (70), Expect = 0.32 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +IND+P ++H+ LFADD+ +Y Sbjct: 212 FINDLPSGIKSHVKLFADDSVLY 234 >SB_5957| Best HMM Match : Chitin_synth_1 (HMM E-Value=9) Length = 416 Score = 41.1 bits (92), Expect = 7e-04 Identities = 28/84 (33%), Positives = 38/84 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 + P L I K E + A++IL D Q FR + SCV Q+ + L Sbjct: 248 FHPSVLKDVICKILEHIVCSHINRHLEAHQILSDRQHAFRKKRSCVTQLCFVINDWASAL 307 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 +R + T A D+AKAFD V H Sbjct: 308 DRG--LQTDASVLDLAKAFDSVPH 329 Score = 35.1 bits (77), Expect = 0.046 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 1/73 (1%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQAPP-SPRYYSV 82 +RL YKLY+ G+ + + +L R R V G +S VT+GVPQ P +++ Sbjct: 330 ERLKYKLYSYGIGGQTLKWNDAFLRERYQRVCVHGAKSSWTWVTSGVPQGTVLGPVLFNL 389 Query: 81 CISMIYPGLRRPI 43 I+ I +R I Sbjct: 390 FINDIQESVRSEI 402 >SB_47691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/62 (35%), Positives = 34/62 (54%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL +S+ RL+ KL + G+ ++ + D+L NR+ V+G S P VT+GV Sbjct: 31 LLDFSKAFDSVSNSRLLIKLQHYGISGQVYYWLEDFLKNRTQSVVVDGEHSSPAIVTSGV 90 Query: 117 PQ 112 PQ Sbjct: 91 PQ 92 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YIND+P + LFADD A+Y Sbjct: 104 YINDLPDEINGKIRLFADDCALY 126 >SB_53688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 491 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/54 (37%), Positives = 27/54 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTE 348 YRPIS++ + K E F+ +KIL + QFGFR HS H + E Sbjct: 429 YRPISIICSFSKILEKLIYNQLIFFLEKHKILFEFQFGFRKGHSTEHAILETVE 482 >SB_48302| Best HMM Match : HORMA (HMM E-Value=1.1) Length = 330 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/54 (37%), Positives = 27/54 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTE 348 YRPIS++ + K E F+ +KIL + QFGFR HS H + E Sbjct: 268 YRPISIICSFSKILEKLIYNQLIFFLEKHKILFEFQFGFRKGHSTEHAILETVE 321 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 40.3 bits (90), Expect = 0.001 Identities = 24/57 (42%), Positives = 30/57 (52%) Frame = -3 Query: 425 NKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVWHN 255 N IL D Q GFR+ SC Q+ T LN + + AL D +KAFDKV H+ Sbjct: 2 NNILSDLQHGFRSGFSCETQLVLTTYDWATSLNNQGQV--DALLLDFSKAFDKVSHS 56 >SB_1875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/54 (37%), Positives = 27/54 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTE 348 YRPIS++ + K E F+ +KIL + QFGFR HS H + E Sbjct: 41 YRPISIICSFSKILEKLIYNQLIFFLEKHKILFEFQFGFRKGHSTEHAILETVE 94 >SB_58397| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/54 (37%), Positives = 27/54 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTE 348 YRPIS++ + K E F+ +KIL + QFGFR HS H + E Sbjct: 220 YRPISIICSFSKILEKLIYNQLIFFLEKHKILFEFQFGFRKGHSTEHAILETVE 273 >SB_54849| Best HMM Match : HORMA (HMM E-Value=0.54) Length = 330 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/54 (37%), Positives = 27/54 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTE 348 YRPIS++ + K E F+ +KIL + QFGFR HS H + E Sbjct: 268 YRPISIICSFSKILEKLIYNQLIFFLEKHKILFEFQFGFRKGHSTEHAILETVE 321 >SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 40.3 bits (90), Expect = 0.001 Identities = 24/57 (42%), Positives = 30/57 (52%) Frame = -3 Query: 425 NKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVWHN 255 N IL D Q GFR+ SC Q+ T LN + + AL D +KAFDKV H+ Sbjct: 2 NNILSDLQHGFRSGFSCETQLVLTTYDWATSLNNQGQV--DALLLDFSKAFDKVSHS 56 Score = 34.7 bits (76), Expect = 0.061 Identities = 22/62 (35%), Positives = 32/62 (51%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL +S+ +L+YKL + G+ + I +LS R+ V GT S VT+GV Sbjct: 43 LLDFSKAFDKVSHSKLLYKLRSYGICGKTCQWITSFLSVRTQFVSVNGTHSSCTPVTSGV 102 Query: 117 PQ 112 PQ Sbjct: 103 PQ 104 Score = 32.7 bits (71), Expect = 0.25 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI +HL LFADDT +Y Sbjct: 116 FINDITLCTRSHLRLFADDTVVY 138 >SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1702 Score = 40.3 bits (90), Expect = 0.001 Identities = 26/84 (30%), Positives = 35/84 (41%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+SL + K E +S + I+ Q GF+ SC Q+ L Sbjct: 397 YRPVSLTSLVCKVMEHIVCKQLTSHLSEHSIISHHQHGFQKGLSCTTQLVSAIHDWASVL 456 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + +F D AKAFD V H Sbjct: 457 NAHGQV--DVIFLDFAKAFDSVPH 478 Score = 29.1 bits (62), Expect = 3.0 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +IND+P ++ + LFADD+ +Y Sbjct: 539 FINDMPSGIQSQVKLFADDSVLY 561 >SB_20057| Best HMM Match : RVT_1 (HMM E-Value=3e-13) Length = 269 Score = 40.3 bits (90), Expect = 0.001 Identities = 36/112 (32%), Positives = 48/112 (42%), Gaps = 3/112 (2%) Frame = -3 Query: 425 NKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVWHNV*Y 246 N IL Q GFR HSC Q+ E L N L D +KAFDKV H Sbjct: 7 NNILFANQHGFRKNHSCETQLLLTVED--LARNTDNGGQIDMLILDFSKAFDKVAHGRLI 64 Query: 245 TNCITWECQTGSCSSYET--TCRTVRSDIESRERVPGPVTS-QPESRKLRPL 99 + + + Q + + ++ T RT R ++ P VTS P+ L PL Sbjct: 65 SKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSVVPQGTVLGPL 116 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/48 (43%), Positives = 30/48 (62%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RLI KL G+ R + I+ +L+NR+ R V+G S+P VT+ VPQ Sbjct: 62 RLISKLLYYGIQGRTLAWIKSWLTNRTQRVVVDGVSSKPVDVTSVVPQ 109 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIYY 8 +IND+ + E L LFADD +Y+ Sbjct: 121 FINDMQENLECTLRLFADDALLYH 144 >SB_13020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 40.3 bits (90), Expect = 0.001 Identities = 20/54 (37%), Positives = 27/54 (50%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTE 348 YRPIS++ + K E F+ +KIL + QFGFR HS H + E Sbjct: 416 YRPISIICSFSKILEKLIYNQLIFFLEKHKILFEFQFGFRKGHSTEHAILETVE 469 >SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1044 Score = 39.9 bits (89), Expect = 0.002 Identities = 29/85 (34%), Positives = 41/85 (48%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E D +S + +L Q GFR R C Q+ +T + L Sbjct: 683 YRPISLTCISCKLLEHIVSKHIMDHLSRHHLLSPFQHGFRERLFCETQL-LVTINDLAQA 741 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHN 255 + +K + T + D +KAFD V H+ Sbjct: 742 SDKK-LDTDLILLDFSKAFDTVSHD 765 Score = 35.9 bits (79), Expect = 0.026 Identities = 22/62 (35%), Positives = 34/62 (54%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL +S+ RL+ KL + + ++ L ++D LSNR+ V+G S VT+GV Sbjct: 752 LLDFSKAFDTVSHDRLLVKLQHYKIDGQVYLWLKDLLSNRTQAVLVDGEISPSCDVTSGV 811 Query: 117 PQ 112 PQ Sbjct: 812 PQ 813 Score = 30.3 bits (65), Expect = 1.3 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIYY 8 +IND+P ++ LFADD A+Y+ Sbjct: 825 FINDLPEGITGNIRLFADDCALYF 848 >SB_58999| Best HMM Match : Exo_endo_phos (HMM E-Value=2.6) Length = 509 Score = 39.9 bits (89), Expect = 0.002 Identities = 26/84 (30%), Positives = 38/84 (45%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRP+SL I + E + + AN+I+ Q GF+ SC ++ + L Sbjct: 421 YRPVSLTSLISQVMEHVVCKHVTNHLCANQIITHLQHGFQQGLSCDTRLTSVIHDWASVL 480 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 N + +F D AKAFD V H Sbjct: 481 NAHGQV--DVVFLDFAKAFDTVPH 502 >SB_3017| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19) Length = 522 Score = 39.9 bits (89), Expect = 0.002 Identities = 28/84 (33%), Positives = 36/84 (42%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K +E + + N IL+ Q GFR SC Q+ E L Sbjct: 322 YRPISLTAVPCKIFEHIIFHDIMNHLDTNNILVKFQHGFRRFFSCETQLITTLEDVGKAL 381 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + + T + D KAFD V H Sbjct: 382 DLGR--QTDLIIMDFTKAFDIVPH 403 Score = 32.7 bits (71), Expect = 0.25 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 QRLI KL G+ L + +L++R V+G S P V++GVPQ Sbjct: 404 QRLISKLDFYGIRGLLKTWLTTWLTHREQSVLVDGVSSAPISVSSGVPQ 452 >SB_50655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2033 Score = 39.5 bits (88), Expect = 0.002 Identities = 29/84 (34%), Positives = 39/84 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPI L K E D +S + L Q GFR R SC Q+ +T + L Sbjct: 1455 YRPIFLTCISCKLLEHIVSKHIMDHLSRHNQLSPFQHGFRGRFSCETQL-LVTINDLAQA 1513 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + +K + T + D +KAFD V H Sbjct: 1514 SDKK-LDTDLILLDFSKAFDSVSH 1536 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIYY 8 +IND+P ++ LFADD +Y+ Sbjct: 1551 FINDLPEGITGNIRLFADDCTLYF 1574 >SB_22397| Best HMM Match : DAO (HMM E-Value=7.6e-06) Length = 456 Score = 39.5 bits (88), Expect = 0.002 Identities = 22/51 (43%), Positives = 27/51 (52%) Frame = -3 Query: 410 DEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVWH 258 + Q FRA HSCV Q+ + L L+R + T A D AKAFD V H Sbjct: 268 NRQHTFRASHSCVTQLCHVANDWALALDR--GLQTDAFILDFAKAFDSVPH 316 >SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) Length = 1061 Score = 39.5 bits (88), Expect = 0.002 Identities = 23/64 (35%), Positives = 35/64 (54%) Frame = -2 Query: 303 SPLLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTA 124 SP + +S+ +RL+YKL G+ L+ + D+L+ RS +EG S VT+ Sbjct: 696 SPEMDFSKAFDRVPHRRLLYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATSSQCSVTS 755 Query: 123 GVPQ 112 GVPQ Sbjct: 756 GVPQ 759 >SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) Length = 186 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/48 (39%), Positives = 29/48 (60%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 RL+ KL + G+ ++ + D+L NR+ V+G S P VT+GVPQ Sbjct: 43 RLLIKLQHYGISGQVYYWLEDFLKNRTQSVVVDGEHSSPVIVTSGVPQ 90 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YIND+P + LFADD A+Y Sbjct: 102 YINDLPDGINGKIRLFADDCALY 124 >SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 366 Score = 39.1 bits (87), Expect = 0.003 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 1/130 (0%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL + K E + V ++ Q GF A SCV Q+ + + +G Sbjct: 51 YRPISLLSVVSKIMERCVFNKIRERVHC--LIQRCQHGFIAGRSCVTQLVEVLD--TIGS 106 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCRTVRSDIESRER 150 + ++ D++KAFD+V H + T + G+ + T+ T RS R Sbjct: 107 HLDNGNQIDVVYLDMSKAFDRVSHRM-LTRKLVQYGFGGNLLKWFTSYITNRS---QRVA 162 Query: 149 VPGPV-TSQP 123 +PG V T QP Sbjct: 163 IPGGVATCQP 172 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L KL G L+ Y++NRS R + G + + VT+GVPQ Sbjct: 133 LTRKLVQYGFGGNLLKWFTSYITNRSQRVAIPGGVATCQPVTSGVPQ 179 >SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15) Length = 345 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/62 (37%), Positives = 33/62 (53%) Frame = -2 Query: 297 LLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGV 118 LL YS+ +L+ KL + G+ + + I +L NRS V G+ S HVT+GV Sbjct: 144 LLDYSKAFDKVSHSKLLKKLSHYGIEGKTLAWISGFLRNRSQYVVVNGSHSSKVHVTSGV 203 Query: 117 PQ 112 PQ Sbjct: 204 PQ 205 Score = 31.1 bits (67), Expect = 0.75 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 YINDI + ++ + LFADDT IY Sbjct: 217 YINDICEASKSQVRLFADDTIIY 239 >SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) Length = 1241 Score = 39.1 bits (87), Expect = 0.003 Identities = 32/85 (37%), Positives = 38/85 (44%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-G 333 YR ISL K E + IL D Q GFRA+ S V Q+ LT H + Sbjct: 518 YRHISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQL-ILTIHDMAKA 576 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 + K I L D +KAFDKV H Sbjct: 577 IQENKSIHAAVL--DFSKAFDKVPH 599 Score = 36.7 bits (81), Expect = 0.015 Identities = 24/70 (34%), Positives = 35/70 (50%) Frame = -2 Query: 321 ETHSDRSPLLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSR 142 E S + +L +S+ +RLI KL G+ L+ +L NR+ +G RS Sbjct: 579 ENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHGPLLYWFMSFLRNRTQTVVCDGKRSC 638 Query: 141 PRHVTAGVPQ 112 P VT+GVPQ Sbjct: 639 PSLVTSGVPQ 648 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 Y+ND+P + ++ + LFADD +Y Sbjct: 660 YVNDLPDNLKSSIRLFADDALLY 682 >SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1410 Score = 39.1 bits (87), Expect = 0.003 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 1/130 (0%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL + K E + V ++ Q GF A SCV Q+ + + +G Sbjct: 494 YRPISLLSVVSKIMERCVFNKIRERVHC--LIQRCQHGFIAGRSCVTQLVEVLD--TIGS 549 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCRTVRSDIESRER 150 + ++ D++KAFD+V H + T + G+ + T+ T RS R Sbjct: 550 HLDNGNQIDVVYLDMSKAFDRVSHRM-LTRKLVQYGFGGNLLKWFTSYITNRS---QRVA 605 Query: 149 VPGPV-TSQP 123 +PG V T QP Sbjct: 606 IPGGVSTCQP 615 Score = 31.5 bits (68), Expect = 0.57 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L KL G L+ Y++NRS R + G S + VT+GVPQ Sbjct: 576 LTRKLVQYGFGGNLLKWFTSYITNRSQRVAIPGGVSTCQPVTSGVPQ 622 >SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 968 Score = 39.1 bits (87), Expect = 0.003 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 1/130 (0%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL + K E + V ++ Q GF A SCV Q+ + + +G Sbjct: 539 YRPISLLSVVSKIMERCVFNKIRERVHC--LIQRCQHGFIAGRSCVTQLVEVLD--TIGS 594 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCRTVRSDIESRER 150 + ++ D++KAFD+V H + T + G+ + T+ T RS R Sbjct: 595 HLDNGNQIDVVYLDMSKAFDRVSHRM-LTRKLVQYGFGGNLLKWFTSYITNRS---QRVA 650 Query: 149 VPGPV-TSQP 123 +PG V T QP Sbjct: 651 IPGGVSTCQP 660 Score = 31.5 bits (68), Expect = 0.57 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L KL G L+ Y++NRS R + G S + VT+GVPQ Sbjct: 621 LTRKLVQYGFGGNLLKWFTSYITNRSQRVAIPGGVSTCQPVTSGVPQ 667 >SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1821 Score = 39.1 bits (87), Expect = 0.003 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 1/130 (0%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL + K E + V ++ Q GF A SCV Q+ + + +G Sbjct: 442 YRPISLLSVVSKIMERCVFNKIRERVHC--LIQRCQHGFIAGRSCVTQLVEVLD--TIGS 497 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCRTVRSDIESRER 150 + ++ D++KAFD+V H + T + G+ + T+ T RS R Sbjct: 498 HLDNGNQIDVVYLDMSKAFDRVSHRM-LTRKLVQYGFGGNLLKWFTSYITNRS---QRVA 553 Query: 149 VPGPV-TSQP 123 +PG V T QP Sbjct: 554 IPGGVSTCQP 563 Score = 31.5 bits (68), Expect = 0.57 Identities = 18/47 (38%), Positives = 24/47 (51%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L KL G L+ Y++NRS R + G S + VT+GVPQ Sbjct: 524 LTRKLVQYGFGGNLLKWFTSYITNRSQRVAIPGGVSTCQPVTSGVPQ 570 >SB_19684| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 617 Score = 39.1 bits (87), Expect = 0.003 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 1/130 (0%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL + K E + V ++ Q GF A SCV Q+ + + +G Sbjct: 302 YRPISLLSVVSKIMERCVFNKIRERVHC--LIQRCQHGFIAGRSCVTQLVEVLD--TIGS 357 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV*YTNCITWECQTGSCSSYETTCRTVRSDIESRER 150 + ++ D++KAFD+V H + T + G+ + T+ T RS R Sbjct: 358 HLDNGNQIDVVYLDMSKAFDRVSHRM-LTRKLVQYGFGGNLLKWFTSYITNRS---QRVA 413 Query: 149 VPGPV-TSQP 123 +PG V T QP Sbjct: 414 IPGGVATCQP 423 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L KL G L+ Y++NRS R + G + + VT+GVPQ Sbjct: 384 LTRKLVQYGFGGNLLKWFTSYITNRSQRVAIPGGVATCQPVTSGVPQ 430 >SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) Length = 455 Score = 38.7 bits (86), Expect = 0.004 Identities = 28/85 (32%), Positives = 40/85 (47%), Gaps = 1/85 (1%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLG- 333 YRP+SL K E + + IL D Q GF R +C Q+ +T H L+ Sbjct: 23 YRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFCKRRNCETQLI-ITCHDLVSA 81 Query: 332 LNRRKPIPTGALFFDIAKAFDKVWH 258 +N+ + A D +KAFD+V H Sbjct: 82 INQGNRVD--AFILDFSKAFDRVPH 104 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +RL+YKL G+ L+ + D+L+ RS +EG S VT+GVPQ Sbjct: 105 RRLLYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATSSQCSVTSGVPQ 153 >SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 396 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +RL+YKL G+ L+ + D+L+ RS +EG S VT+GVPQ Sbjct: 46 RRLLYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATSSQCSVTSGVPQ 94 >SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) Length = 447 Score = 38.7 bits (86), Expect = 0.004 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +RL+YKL G+ L+ + D+L+ RS +EG S VT+GVPQ Sbjct: 97 RRLLYKLSYYGIRGSLLTWMEDFLTQRSQCVTLEGATSSQCSVTSGVPQ 145 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 38.3 bits (85), Expect = 0.005 Identities = 39/133 (29%), Positives = 55/133 (41%), Gaps = 5/133 (3%) Frame = -3 Query: 536 GXTEERNXXYRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHR 357 G +RN YR ISLL GK + A ++ + Q GFR+ S V + Sbjct: 2106 GDRSDRNN-YRGISLLCIAGKLFARVALNRLQKL--AERVYPESQCGFRSNRSTVDMIFS 2162 Query: 356 LTEHXLLGLNRRKPIPTGALFFDIAKAFDKV-----WHNV*YTNCITWECQTGSCSSYET 192 L + L R + P F D+ KAFD V +H + C + S +E Sbjct: 2163 LRQ--LQEKCREQQRPLFVAFIDLTKAFDSVSRDGLFHILPLVGCPP-KLLNFIKSFHEG 2219 Query: 191 TCRTVRSDIESRE 153 TC TV+ + S E Sbjct: 2220 TCGTVKCESNSSE 2232 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 38.3 bits (85), Expect = 0.005 Identities = 29/82 (35%), Positives = 35/82 (42%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E +S IL + Q GFR SC Q+ L Sbjct: 849 YRPISLTCLCCKTMEHIVLSHLNKHLSRFNILSNAQHGFRQGLSCETQLVLTFHDWATVL 908 Query: 329 NRRKPIPTGALFFDIAKAFDKV 264 N+ + AL D +KAFDKV Sbjct: 909 NKHGQV--DALLLDFSKAFDKV 928 Score = 35.1 bits (77), Expect = 0.046 Identities = 19/48 (39%), Positives = 26/48 (54%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +LI+KL G+ + I +L NRS V G+ S VT+GVPQ Sbjct: 932 KLIHKLSRYGIKGNTLTWISAFLHNRSQFVTVNGSHSATCRVTSGVPQ 979 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI S + L LFADDT +Y Sbjct: 991 FINDIAESSNSRLRLFADDTVVY 1013 >SB_59519| Best HMM Match : RVT_1 (HMM E-Value=3.5e-11) Length = 214 Score = 37.9 bits (84), Expect = 0.007 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = -3 Query: 437 FVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVWH 258 F++ IL D+QFGFR H+ H + + + + + +F D +KAFD V H Sbjct: 8 FINKYNILYDKQFGFREHHTTFHATLLIVDKIQRAIEEGQ--YSCGIFLDFSKAFDTVDH 65 Query: 257 NV 252 + Sbjct: 66 KI 67 >SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) Length = 314 Score = 37.9 bits (84), Expect = 0.007 Identities = 24/59 (40%), Positives = 30/59 (50%) Frame = -3 Query: 434 VSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVWH 258 +SA IL D Q GFR+ SC Q+ T LN + A+ D +KAFDKV H Sbjct: 13 LSAFNILSDLQHGFRSGFSCETQLILATHDWASTLNSHGQV--DAIMLDFSKAFDKVSH 69 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +L +KL++ G+ + + I +L+NR+ V+G+ S VT+GVPQ Sbjct: 71 KLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSGVPQ 118 >SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36) Length = 295 Score = 37.9 bits (84), Expect = 0.007 Identities = 31/83 (37%), Positives = 37/83 (44%), Gaps = 1/83 (1%) Frame = -3 Query: 503 PISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-GLN 327 PISL K E + IL D Q GFRA+ S V Q+ LT H + + Sbjct: 44 PISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQL-ILTIHDMAKAIQ 102 Query: 326 RRKPIPTGALFFDIAKAFDKVWH 258 K I L D +KAFDKV H Sbjct: 103 ENKSIHAAVL--DFSKAFDKVPH 123 Score = 36.7 bits (81), Expect = 0.015 Identities = 24/70 (34%), Positives = 35/70 (50%) Frame = -2 Query: 321 ETHSDRSPLLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSR 142 E S + +L +S+ +RLI KL G+ L+ +L NR+ +G RS Sbjct: 103 ENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHGPLLYWFMSFLRNRTQTVVCDGKRSC 162 Query: 141 PRHVTAGVPQ 112 P VT+GVPQ Sbjct: 163 PSLVTSGVPQ 172 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 Y+ND+P + ++ + LFADD +Y Sbjct: 184 YVNDLPDNLKSSIRLFADDALLY 206 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 37.9 bits (84), Expect = 0.007 Identities = 31/83 (37%), Positives = 37/83 (44%), Gaps = 1/83 (1%) Frame = -3 Query: 503 PISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLL-GLN 327 PISL K E + IL D Q GFRA+ S V Q+ LT H + + Sbjct: 180 PISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQL-ILTIHDMAKAIQ 238 Query: 326 RRKPIPTGALFFDIAKAFDKVWH 258 K I L D +KAFDKV H Sbjct: 239 ENKSIHAAVL--DFSKAFDKVPH 259 Score = 36.7 bits (81), Expect = 0.015 Identities = 24/70 (34%), Positives = 35/70 (50%) Frame = -2 Query: 321 ETHSDRSPLLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSR 142 E S + +L +S+ +RLI KL G+ L+ +L NR+ +G RS Sbjct: 239 ENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHGPLLYWFMSFLRNRTQTVVCDGKRSC 298 Query: 141 PRHVTAGVPQ 112 P VT+GVPQ Sbjct: 299 PSLVTSGVPQ 308 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 Y+ND+P + ++ + LFADD +Y Sbjct: 320 YVNDLPDNLKSSIRLFADDALLY 342 >SB_54393| Best HMM Match : RNA_pol_Rpc34 (HMM E-Value=9.3e-10) Length = 252 Score = 37.9 bits (84), Expect = 0.007 Identities = 26/86 (30%), Positives = 41/86 (47%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISLL + K E + V ++ Q GF A SCV Q+ + + +G Sbjct: 143 YRPISLLSVVSKIMERCVFNKIRERVHC--LIQRYQHGFIAGRSCVTQLVEVLD--TIGS 198 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 + ++ D++KAFD+V H + Sbjct: 199 HLDNGNQIDVVYLDMSKAFDRVSHRM 224 >SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) Length = 591 Score = 37.9 bits (84), Expect = 0.007 Identities = 20/61 (32%), Positives = 31/61 (50%) Frame = -3 Query: 440 DFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVW 261 D + N IL+ Q GFR ++SC Q+ + L++ T + D +KAFD+V Sbjct: 101 DQIPCNNILLHIQHGFRKKYSCETQLITVLHELCYNLDQGN--QTDCILLDFSKAFDRVA 158 Query: 260 H 258 H Sbjct: 159 H 159 Score = 34.3 bits (75), Expect = 0.080 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQAPP-SPRYYSVC 79 RL+ KL G+ + + +R +L +R+ VEG S+ VT+GVPQ P + + Sbjct: 161 RLLQKLDFYGIRGKPLTWVRSWLIHRNQTVVVEGETSKSTRVTSGVPQGTVLGPLMFLLF 220 Query: 78 ISMIYPGL 55 I+ I G+ Sbjct: 221 INDINSGI 228 >SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 880 Score = 37.5 bits (83), Expect = 0.009 Identities = 27/86 (31%), Positives = 41/86 (47%) Frame = -3 Query: 521 RNXXYRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHX 342 R YRPI+LL + K YE + L +R +HSC + +LTE Sbjct: 486 REKNYRPITLLCIVDKVYESMMSTQVNNHFDPK--LDPCLSAYRKKHSCETTLLKLTEDW 543 Query: 341 LLGLNRRKPIPTGALFFDIAKAFDKV 264 L ++ ++ I G L D++KAFD + Sbjct: 544 KLAVDSKQFI--GILSTDMSKAFDSL 567 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 ++ KL G ++ + ++R Y +NR R ++ G S + G PQ Sbjct: 572 MVNKLKAYGFSEQSLHLMRSYFTNRQNRVKLNGVTSVWKDAVRGCPQ 618 >SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 37.5 bits (83), Expect = 0.009 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (3%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQV---HRLTEHXL 339 +R I+LL ++GK + +++ KI+ EQ GFR H V + L + + Sbjct: 910 FRGITLLSSLGKVFTSIMNNRLYNYLVERKIIKPEQGGFRKEHGTVDSIFILKSLIDKYV 969 Query: 338 LGLNRRKPIPTGALFFDIAKAFDKV 264 ++K + D +KAFD+V Sbjct: 970 KAKPKKKQNFLFTCYVDFSKAFDRV 994 >SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 37.5 bits (83), Expect = 0.009 Identities = 22/59 (37%), Positives = 31/59 (52%) Frame = -3 Query: 434 VSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVWH 258 +S++ ILI++Q GFR + SC Q+ +N R T L D +KAFD V H Sbjct: 13 LSSHNILINQQHGFREKFSCETQLISAIHDWAKTINFRG--QTDVLLLDFSKAFDSVPH 69 Score = 35.9 bits (79), Expect = 0.026 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 QRL+ KL G+ ++ I+ ++SNR V GT S + V +GVPQ Sbjct: 70 QRLLIKLDFYGIRGNMLNWIKAFVSNRKQSVSVNGTVSSSKSVVSGVPQ 118 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI S +++L LFADD +Y Sbjct: 130 FINDISTSIQSNLRLFADDCVLY 152 >SB_33535| Best HMM Match : RVT_1 (HMM E-Value=1.4013e-45) Length = 469 Score = 37.5 bits (83), Expect = 0.009 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (3%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQV---HRLTEHXL 339 +R I+LL ++GK + +++ KI+ EQ GFR H V + L + + Sbjct: 207 FRGITLLSSLGKVFTSIMNNRLYNYLVERKIIKPEQGGFRKEHGTVDSIFILKSLIDKYV 266 Query: 338 LGLNRRKPIPTGALFFDIAKAFDKV 264 ++K + D +KAFD+V Sbjct: 267 KAKPKKKQNFLFTCYVDFSKAFDRV 291 >SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) Length = 388 Score = 37.5 bits (83), Expect = 0.009 Identities = 22/59 (37%), Positives = 31/59 (52%) Frame = -3 Query: 434 VSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVWH 258 +S++ ILI++Q GFR + SC Q+ +N R T L D +KAFD V H Sbjct: 13 LSSHNILINQQHGFREKFSCETQLISAIHDWAKTINFRG--QTDVLLLDFSKAFDSVPH 69 Score = 35.9 bits (79), Expect = 0.026 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 QRL+ KL G+ ++ I+ ++SNR V GT S + V +GVPQ Sbjct: 70 QRLLIKLDFYGIRGNMLNWIKAFVSNRKQSVSVNGTVSSSKSVVSGVPQ 118 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 +INDI S +++L LFADD +Y Sbjct: 130 FINDISTSIQSNLRLFADDCVLY 152 >SB_32319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 37.5 bits (83), Expect = 0.009 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (3%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQV---HRLTEHXL 339 +R I+LL ++GK + +++ KI+ EQ GFR H V + L + + Sbjct: 207 FRGITLLSSLGKVFTSIMNNRLYNYLVERKIIKPEQGGFRKEHGTVDSIFILKSLIDKYV 266 Query: 338 LGLNRRKPIPTGALFFDIAKAFDKV 264 ++K + D +KAFD+V Sbjct: 267 KAKPKKKQNFLFTCYVDFSKAFDRV 291 >SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1134 Score = 37.5 bits (83), Expect = 0.009 Identities = 27/84 (32%), Positives = 36/84 (42%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + + + IL+ Q GFR SC Q+ E L Sbjct: 658 YRPISLTAVPCKILEHIIFHDIMNHIDTHNILVKFQHGFRRFFSCETQLITTLEDVGKAL 717 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + + T + D +KAFD V H Sbjct: 718 DLGR--QTDLIIMDFSKAFDIVPH 739 Score = 32.7 bits (71), Expect = 0.25 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 QRLI KL G+ L + +L++R V+G S P V++GVPQ Sbjct: 740 QRLISKLDFYGIRGLLKTWLTTWLTHREQSVLVDGVSSAPISVSSGVPQ 788 >SB_20001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 37.5 bits (83), Expect = 0.009 Identities = 29/86 (33%), Positives = 40/86 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPIS+LPAI K E DF++ N++L Q G R L Sbjct: 11 YRPISILPAISKVIERIVYEQVYDFLTENQLLNRCQSGLR---------------DLWLR 55 Query: 329 NRRKPIPTGALFFDIAKAFDKVWHNV 252 N + + T +F D+ KAFD V H++ Sbjct: 56 NMDQSLLTANVFNDLKKAFDTVDHSI 81 >SB_17856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 37.5 bits (83), Expect = 0.009 Identities = 28/82 (34%), Positives = 34/82 (41%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YR I+LL GK + D V + L D+Q GFR SC Q+ L L Sbjct: 30 YRGITLLSIPGKVFNRILLNRMKDAVDPH--LRDQQAGFRKERSCTDQIATLRIILEQSL 87 Query: 329 NRRKPIPTGALFFDIAKAFDKV 264 P+ F D KAFD V Sbjct: 88 EWNSPLYVN--FIDYEKAFDSV 107 >SB_57858| Best HMM Match : RNA_pol_A_CTD (HMM E-Value=5.7) Length = 280 Score = 37.1 bits (82), Expect = 0.011 Identities = 18/49 (36%), Positives = 23/49 (46%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQV 363 YRP+SL + K E + + N IL Q GFR HSC Q+ Sbjct: 207 YRPVSLTTVLCKLMEHVIYKNIMEHLENNNILFANQHGFRKNHSCETQL 255 >SB_25560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 629 Score = 37.1 bits (82), Expect = 0.011 Identities = 28/82 (34%), Positives = 34/82 (41%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YR I+LL GK + D V + L D+Q GFR SC Q+ L L Sbjct: 436 YRGITLLSIPGKVFNRILLNRMKDAVDPH--LRDQQAGFRKERSCTDQIATLRIILEQSL 493 Query: 329 NRRKPIPTGALFFDIAKAFDKV 264 P+ F D KAFD V Sbjct: 494 EWNSPLYIN--FIDYEKAFDSV 513 >SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 37.1 bits (82), Expect = 0.011 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 LI KL G+ D+ + + YLSNR + V S+PR +T GVPQ Sbjct: 34 LIDKLNWYGISDQPLTWFQSYLSNRKQQCMVNWHLSKPRTITCGVPQ 80 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 36.7 bits (81), Expect = 0.015 Identities = 29/91 (31%), Positives = 39/91 (42%) Frame = -3 Query: 536 GXTEERNXXYRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHR 357 G +RN YR ISLL GK + A ++ + Q GFR+ S V + Sbjct: 186 GDRSDRNN-YRGISLLCIAGKLFARVALNRLQKL--AERVYPESQCGFRSNRSTVDMIFS 242 Query: 356 LTEHXLLGLNRRKPIPTGALFFDIAKAFDKV 264 L + L R + P F D+ KAFD V Sbjct: 243 LRQ--LQEKCREQERPLFVAFIDLTKAFDSV 271 >SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) Length = 590 Score = 36.7 bits (81), Expect = 0.015 Identities = 29/91 (31%), Positives = 39/91 (42%) Frame = -3 Query: 536 GXTEERNXXYRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHR 357 G +RN YR ISLL GK + A ++ + Q GFR+ S V + Sbjct: 226 GDRSDRNN-YRGISLLCIAGKLFARVALNRLQKL--AERVYPESQCGFRSNRSTVDMIFS 282 Query: 356 LTEHXLLGLNRRKPIPTGALFFDIAKAFDKV 264 L + L R + P F D+ KAFD V Sbjct: 283 LRQ--LQEKCREQQRPIFVAFIDLTKAFDSV 311 >SB_31085| Best HMM Match : RVT_1 (HMM E-Value=0.0094) Length = 270 Score = 36.7 bits (81), Expect = 0.015 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 1/73 (1%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQAPP-SPRYYSV 82 +RL KLY+ G+ + + I +L R R V G +S VT+GVPQ P ++V Sbjct: 48 ERLKSKLYSYGIGGQTLKWIDAFLCERFQRVCVNGAKSSWTRVTSGVPQGTVLGPVLFNV 107 Query: 81 CISMIYPGLRRPI 43 I+ I +R I Sbjct: 108 FINDIQESIRSEI 120 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIYYS 5 +INDI S + + LFADD Y++ Sbjct: 108 FINDIQESIRSEIRLFADDCICYHT 132 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 36.7 bits (81), Expect = 0.015 Identities = 24/70 (34%), Positives = 35/70 (50%) Frame = -2 Query: 321 ETHSDRSPLLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSR 142 E S + +L +S+ +RLI KL G+ L+ +L NR+ +G RS Sbjct: 7 ENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHGPLLYWFMSFLRNRTQTVVCDGKRSC 66 Query: 141 PRHVTAGVPQ 112 P VT+GVPQ Sbjct: 67 PSLVTSGVPQ 76 Score = 29.5 bits (63), Expect = 2.3 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 Y+ND+P + ++ + LFADD +Y Sbjct: 88 YVNDLPDNLKSSIRLFADDALLY 110 >SB_23472| Best HMM Match : HIT (HMM E-Value=0.43) Length = 168 Score = 36.7 bits (81), Expect = 0.015 Identities = 27/84 (32%), Positives = 36/84 (42%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + + + IL+ Q GFR SC Q+ E L Sbjct: 29 YRPISLTAVPCKILEHIIFHDIMNHLDTHNILVKFQHGFRRFFSCETQLITTLEDVGKAL 88 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + + T + D +KAFD V H Sbjct: 89 DLGR--QTDLIIMDFSKAFDIVPH 110 Score = 31.9 bits (69), Expect = 0.43 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 QRLI KL G+ L + +L +R V+G S P V++GVPQ Sbjct: 111 QRLISKLDFYGIRGLLKTWLTTWLRHREQSVLVDGVSSAPISVSSGVPQ 159 >SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) Length = 252 Score = 36.7 bits (81), Expect = 0.015 Identities = 27/84 (32%), Positives = 36/84 (42%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + + + IL+ Q GFR SC Q+ E L Sbjct: 74 YRPISLTAVPCKILEHIIFHDIMNHLDTHNILVKFQHGFRRFFSCETQLITTLEDVGKAL 133 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + + T + D +KAFD V H Sbjct: 134 DLGR--QTDLIIMDFSKAFDIVPH 155 Score = 32.7 bits (71), Expect = 0.25 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 QRLI KL G+ L + +L++R V+G S P V++GVPQ Sbjct: 156 QRLISKLDFYGIRGLLKTWLTTWLTHREQSVLVDGVSSAPISVSSGVPQ 204 >SB_14910| Best HMM Match : RVT_1 (HMM E-Value=0.47) Length = 193 Score = 36.7 bits (81), Expect = 0.015 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = -2 Query: 252 LIYKL-YNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+YKL ++ G+ L+ + YLSNR R V G S VT+GVPQ Sbjct: 47 LLYKLEHSFGISCSLLCWFQSYLSNRRQRVTVLGFTSSEASVTSGVPQ 94 >SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) Length = 661 Score = 36.7 bits (81), Expect = 0.015 Identities = 29/91 (31%), Positives = 39/91 (42%) Frame = -3 Query: 536 GXTEERNXXYRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHR 357 G +RN YR ISLL GK + A ++ + Q GFR+ S V + Sbjct: 180 GDRSDRNN-YRGISLLCIAGKLFARVALNRLQKL--AERVYPESQCGFRSNRSTVDMIFS 236 Query: 356 LTEHXLLGLNRRKPIPTGALFFDIAKAFDKV 264 L + L R + P F D+ KAFD V Sbjct: 237 LRQ--LQEKCREQQRPLFVAFIDLTKAFDSV 265 >SB_56675| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-08) Length = 545 Score = 36.7 bits (81), Expect = 0.015 Identities = 29/91 (31%), Positives = 39/91 (42%) Frame = -3 Query: 536 GXTEERNXXYRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHR 357 G +RN YR ISLL GK + A ++ + Q GFR+ S V + Sbjct: 378 GDRSDRNN-YRGISLLCIAGKLFARVALNRLQKL--AERVYPESQCGFRSNRSTVDMIFS 434 Query: 356 LTEHXLLGLNRRKPIPTGALFFDIAKAFDKV 264 L + L R + P F D+ KAFD V Sbjct: 435 LRQ--LQEKCREQQRPLFVAFIDLTKAFDSV 463 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 36.7 bits (81), Expect = 0.015 Identities = 29/91 (31%), Positives = 39/91 (42%) Frame = -3 Query: 536 GXTEERNXXYRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHR 357 G +RN YR ISLL GK + A ++ + Q GFR+ S V + Sbjct: 15 GDRSDRNN-YRGISLLCIAGKLFARVALNRLQKL--AERVYPESQCGFRSNRSTVDMIFS 71 Query: 356 LTEHXLLGLNRRKPIPTGALFFDIAKAFDKV 264 L + L R + P F D+ KAFD V Sbjct: 72 LRQ--LQEKCREQQRPLFVAFIDLTKAFDSV 100 >SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 36.7 bits (81), Expect = 0.015 Identities = 27/84 (32%), Positives = 36/84 (42%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + + + IL+ Q GFR SC Q+ E L Sbjct: 163 YRPISLTAVPCKILEHIIFHDIMNHLDTHNILVKFQHGFRRFFSCEMQLITTLEDVGKAL 222 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + + T + D +KAFD V H Sbjct: 223 DLGR--QTDLIIMDFSKAFDIVPH 244 >SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 36.7 bits (81), Expect = 0.015 Identities = 29/91 (31%), Positives = 39/91 (42%) Frame = -3 Query: 536 GXTEERNXXYRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHR 357 G +RN YR ISLL GK + A ++ + Q GFR+ S V + Sbjct: 308 GDRSDRNN-YRGISLLCIAGKLFARVALNRLQKL--AERVYPESQCGFRSNRSTVDMIFS 364 Query: 356 LTEHXLLGLNRRKPIPTGALFFDIAKAFDKV 264 L + L R + P F D+ KAFD V Sbjct: 365 LRQ--LQEKCREQQRPLFVAFIDLTKAFDSV 393 >SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) Length = 1845 Score = 36.7 bits (81), Expect = 0.015 Identities = 21/48 (43%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -2 Query: 252 LIYKL-YNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+YKL ++ G+ L+ YLSNR R V G S VT+GVPQ Sbjct: 1604 LLYKLEHSFGISGSLLCWFHSYLSNRRQRVIVLGCTSSEASVTSGVPQ 1651 >SB_36757| Best HMM Match : RVT_1 (HMM E-Value=4.1e-28) Length = 381 Score = 36.7 bits (81), Expect = 0.015 Identities = 29/91 (31%), Positives = 39/91 (42%) Frame = -3 Query: 536 GXTEERNXXYRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHR 357 G +RN YR ISLL GK + A ++ + Q GFR+ S V + Sbjct: 141 GDRSDRNN-YRGISLLCIAGKLFARVALNRLQKL--AERVYPESQCGFRSNRSTVDMIFS 197 Query: 356 LTEHXLLGLNRRKPIPTGALFFDIAKAFDKV 264 L + L R + P F D+ KAFD V Sbjct: 198 LRQ--LQEKCREQQRPLFVAFIDLTKAFDSV 226 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 36.7 bits (81), Expect = 0.015 Identities = 24/70 (34%), Positives = 35/70 (50%) Frame = -2 Query: 321 ETHSDRSPLLRYSEGVR*SLAQRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSR 142 E S + +L +S+ +RLI KL G+ L+ +L NR+ +G RS Sbjct: 415 ENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHGPLLYWFMSFLRNRTQTVVCDGKRSC 474 Query: 141 PRHVTAGVPQ 112 P VT+GVPQ Sbjct: 475 PSLVTSGVPQ 484 Score = 28.7 bits (61), Expect = 4.0 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 79 YINDIPRSPETHLALFADDTAIY 11 Y+ND+P + ++ + LFADD +Y Sbjct: 496 YMNDLPDNLKSSIRLFADDALLY 518 >SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) Length = 409 Score = 36.7 bits (81), Expect = 0.015 Identities = 23/59 (38%), Positives = 30/59 (50%) Frame = -3 Query: 434 VSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGLNRRKPIPTGALFFDIAKAFDKVWH 258 +SA IL + Q GFR+ SC Q+ T LN + A+ D +KAFDKV H Sbjct: 13 LSAFNILSEMQHGFRSGFSCETQLILATHDWASTLNSHGQV--DAIMLDFSKAFDKVSH 69 Score = 33.1 bits (72), Expect = 0.19 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = -2 Query: 255 RLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 +L +KL++ G+ + + I +L+NR+ V+G+ S VT+GVPQ Sbjct: 71 KLSHKLHHCGIRGKTLGWIEAFLNNRNQFVVVDGSHSSQVPVTSGVPQ 118 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 36.7 bits (81), Expect = 0.015 Identities = 27/84 (32%), Positives = 36/84 (42%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + + + IL+ Q GFR SC Q+ E L Sbjct: 277 YRPISLTAVPCKILEHIIFHDIMNHLDTHNILVKFQHGFRRFFSCETQLITTLEDVGKAL 336 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + + T + D +KAFD V H Sbjct: 337 DLGR--QTDLIIMDFSKAFDIVPH 358 >SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 979 Score = 36.7 bits (81), Expect = 0.015 Identities = 27/84 (32%), Positives = 36/84 (42%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPISL K E + + + IL+ Q GFR SC Q+ E L Sbjct: 114 YRPISLTAVPCKILEHIIFHDIMNHLDTHNILVKFQHGFRRFFSCETQLITTLEDVGKAL 173 Query: 329 NRRKPIPTGALFFDIAKAFDKVWH 258 + + T + D +KAFD V H Sbjct: 174 DLGR--QTDLIIMDFSKAFDIVPH 195 Score = 32.7 bits (71), Expect = 0.25 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = -2 Query: 258 QRLIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 QRLI KL G+ L + +L++R V+G S P V++GVPQ Sbjct: 196 QRLISKLDFYGIRGLLKTWLTTWLTHREQSVLVDGVSSAPISVSSGVPQ 244 >SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42) Length = 717 Score = 36.7 bits (81), Expect = 0.015 Identities = 29/91 (31%), Positives = 39/91 (42%) Frame = -3 Query: 536 GXTEERNXXYRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHR 357 G +RN YR ISLL GK + A ++ + Q GFR+ S V + Sbjct: 370 GDRSDRNN-YRGISLLCIAGKLFARVALNRLQKL--AERVYPESQCGFRSNRSTVDMIFS 426 Query: 356 LTEHXLLGLNRRKPIPTGALFFDIAKAFDKV 264 L + L R + P F D+ KAFD V Sbjct: 427 LRQ--LQEKCREQQRPLFVAFIDLTKAFDSV 455 >SB_56872| Best HMM Match : RVT_1 (HMM E-Value=2.7e-30) Length = 575 Score = 36.3 bits (80), Expect = 0.020 Identities = 26/82 (31%), Positives = 40/82 (48%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPI+LL + K YE + L +R +HSC + +LTE L + Sbjct: 313 YRPITLLCIVDKVYESMMSTQVNNHFDPK--LDPCLSAYRKKHSCETTLLKLTEDWKLAV 370 Query: 329 NRRKPIPTGALFFDIAKAFDKV 264 + ++ I G L D++KAFD + Sbjct: 371 DSKQFI--GILSTDMSKAFDSL 390 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 ++ KL G ++ + ++R Y +NR R ++ G S + G PQ Sbjct: 395 MVNKLKAYGFSEQSLHLMRSYFTNRQNRVKLNGVTSVWKDAVRGCPQ 441 >SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 490 Score = 36.3 bits (80), Expect = 0.020 Identities = 26/82 (31%), Positives = 40/82 (48%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPI+LL + K YE + L +R +HSC + +LTE L + Sbjct: 119 YRPITLLCIVDKVYESMMSTQVNNHFDPK--LDPCLSAYRKKHSCETTLLKLTEDWKLAV 176 Query: 329 NRRKPIPTGALFFDIAKAFDKV 264 + ++ I G L D++KAFD + Sbjct: 177 DSKQFI--GILSTDMSKAFDSL 196 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 ++ KL G ++ + ++R Y +NR R ++ G S + G PQ Sbjct: 201 MVNKLKAYGFSEQSLHLMRSYFTNRQNRVKLNGVTSVWKDAVRGCPQ 247 >SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1858 Score = 36.3 bits (80), Expect = 0.020 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 3/85 (3%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRL---TEHXL 339 YR I+LL + K + D++ L EQ GFR +HS V + L + + Sbjct: 1347 YRGITLLSCLSKLFTSILNSRLYDYLVQKGYLKKEQGGFRKKHSTVDSIFILKTVIDRVV 1406 Query: 338 LGLNRRKPIPTGALFFDIAKAFDKV 264 ++K F D KAFD + Sbjct: 1407 KSKPKKKNNMLFTCFIDFRKAFDSI 1431 >SB_38578| Best HMM Match : RVT_1 (HMM E-Value=0.018) Length = 472 Score = 36.3 bits (80), Expect = 0.020 Identities = 26/82 (31%), Positives = 40/82 (48%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPI+LL + K YE + L +R +HSC + +LTE L + Sbjct: 241 YRPITLLCIVDKVYESMMSTQVNNHFDPK--LDPCLSAYRKKHSCETTLLKLTEDWKLAV 298 Query: 329 NRRKPIPTGALFFDIAKAFDKV 264 + ++ I G L D++KAFD + Sbjct: 299 DSKQFI--GILSTDMSKAFDSL 318 >SB_8718| Best HMM Match : Lipase_GDSL (HMM E-Value=0.023) Length = 836 Score = 36.3 bits (80), Expect = 0.020 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 3/85 (3%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRL---TEHXL 339 YR I+LL + K + D++ L EQ GFR +HS V + L + + Sbjct: 704 YRGITLLSCLSKLFTSILNSRLYDYLVQKGYLKKEQGGFRKKHSTVDSIFILKTVIDRVV 763 Query: 338 LGLNRRKPIPTGALFFDIAKAFDKV 264 ++K F D KAFD + Sbjct: 764 KSKPKKKNNMLFTCFIDFRKAFDSI 788 >SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 558 Score = 36.3 bits (80), Expect = 0.020 Identities = 26/82 (31%), Positives = 40/82 (48%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPI+LL + K YE + L +R +HSC + +LTE L + Sbjct: 119 YRPITLLCIVDKVYESMMSTQVNNHFDPK--LDPCLSAYRKKHSCETTLLKLTEDWKLAV 176 Query: 329 NRRKPIPTGALFFDIAKAFDKV 264 + ++ I G L D++KAFD + Sbjct: 177 DSKQFI--GILSTDMSKAFDSL 196 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 ++ KL G ++ + ++R Y +NR R ++ G S + G PQ Sbjct: 201 MVNKLKAYGFSEQSLHLMRSYFTNRQNRVKLNGVTSVWKDAVRGCPQ 247 >SB_59736| Best HMM Match : RVT_1 (HMM E-Value=8.2e-31) Length = 326 Score = 36.3 bits (80), Expect = 0.020 Identities = 26/82 (31%), Positives = 40/82 (48%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YRPI+LL + K YE + L +R +HSC + +LTE L + Sbjct: 64 YRPITLLCIVDKVYESMMSTQVNNHFDPK--LDPCLSAYRKKHSCETTLLKLTEDWKLAV 121 Query: 329 NRRKPIPTGALFFDIAKAFDKV 264 + ++ I G L D++KAFD + Sbjct: 122 DSKQFI--GILSTDMSKAFDSL 141 Score = 29.1 bits (62), Expect = 3.0 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = -2 Query: 252 LIYKLYNMGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 112 L+ KL G ++ + ++R Y +NR R ++ G S + G PQ Sbjct: 146 LVNKLKAYGFSEQSLHLMRSYFTNRQNRVKLNGVTSVWKDAVRGCPQ 192 >SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) Length = 492 Score = 36.3 bits (80), Expect = 0.020 Identities = 27/82 (32%), Positives = 35/82 (42%) Frame = -3 Query: 509 YRPISLLPAIGKXYEXXXXXXXXDFVSANKILIDEQFGFRARHSCVHQVHRLTEHXLLGL 330 YR I+LL GK + D V + L ++Q GFR + SC Q+ L L Sbjct: 63 YRGITLLSIPGKVFNRILLNRMKDAVDPH--LRNQQAGFRKKRSCTDQIATLRIILEQSL 120 Query: 329 NRRKPIPTGALFFDIAKAFDKV 264 P+ F D KAFD V Sbjct: 121 EWNSPLYVN--FIDYEKAFDSV 140 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,284,146 Number of Sequences: 59808 Number of extensions: 420840 Number of successful extensions: 2694 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2525 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -