BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0890 (829 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16D10.07c |sir2||Sir2 family histone deacetylase Sir2|Schizo... 28 1.9 SPBPJ4664.06 |gpt1||UDP-glucose-glycoprotein glucosyltransferase... 26 7.5 SPAC12B10.07 |acp1||F-actin capping protein alpha subunit|Schizo... 26 7.5 SPBC25D12.06 |||RNA helicase |Schizosaccharomyces pombe|chr 2|||... 26 7.5 SPAC23G3.11 |rpn6||19S proteasome regulatory subunit Rpn6|Schizo... 25 9.9 SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyce... 25 9.9 SPBC577.05c |rec27|mug41|meiotic recombination protein Rec27|Sch... 25 9.9 >SPBC16D10.07c |sir2||Sir2 family histone deacetylase Sir2|Schizosaccharomyces pombe|chr 2|||Manual Length = 475 Score = 27.9 bits (59), Expect = 1.9 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 401 LDERKDQRRHVRLRFYCRVLPQNRLQGSLPARSL 502 LDER + R++R Y + L + ++ LP RS+ Sbjct: 69 LDERSEMVRYLRASGYAKFLEKYLIEEELPVRSI 102 >SPBPJ4664.06 |gpt1||UDP-glucose-glycoprotein glucosyltransferase Gpt1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1448 Score = 25.8 bits (54), Expect = 7.5 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 82 VFTKEPMVNLDMKMKELCIMKLLDHILQPTMFEDIKEIAKEYNIE 216 + TK + + D K+K +++ L P+ I IAK+YN E Sbjct: 1174 IMTKSVIEHTDKKVK----FWFIENFLSPSFKSSIPAIAKKYNFE 1214 >SPAC12B10.07 |acp1||F-actin capping protein alpha subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 256 Score = 25.8 bits (54), Expect = 7.5 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +1 Query: 151 DHILQPTMFEDIKEI--AKEYNIEKSCDKYMNVDVVNSSWRCI 273 DH L F IK+ + + I KY + N SWRCI Sbjct: 116 DHYLSDVTFGIIKKSDEVESFTIVLVSSKYNPKNYWNGSWRCI 158 >SPBC25D12.06 |||RNA helicase |Schizosaccharomyces pombe|chr 2|||Manual Length = 565 Score = 25.8 bits (54), Expect = 7.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 Query: 193 IAKEYNIEKSCDKYMNVDVVNSSWRC 270 + KE+N C++Y V N W+C Sbjct: 431 LPKEFNPHSFCNQYKGFAVGNRFWQC 456 >SPAC23G3.11 |rpn6||19S proteasome regulatory subunit Rpn6|Schizosaccharomyces pombe|chr 1|||Manual Length = 421 Score = 25.4 bits (53), Expect = 9.9 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = -2 Query: 681 RFGIKERRTPXRQSITTKLSSV 616 ++ IKE+RT RQ++ TKL S+ Sbjct: 113 KWAIKEKRTFLRQALETKLISL 134 >SPAC25B8.16 |||RNase P and RNase MRP subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 698 Score = 25.4 bits (53), Expect = 9.9 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +2 Query: 593 WKYY-GITVTDDNLVVIDWR 649 W Y GI V DD + + DWR Sbjct: 317 WNYLSGIAVLDDRIAMHDWR 336 >SPBC577.05c |rec27|mug41|meiotic recombination protein Rec27|Schizosaccharomyces pombe|chr 2|||Manual Length = 134 Score = 25.4 bits (53), Expect = 9.9 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = +1 Query: 103 VNLDMKMKELCIMKLLDHILQPTMFEDIKEIAKEYN 210 VNL K ++ ++++H+L+ ++I+ K+Y+ Sbjct: 12 VNLKKKQLQITSSEIIEHVLEELNLKNIERRVKKYD 47 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,005,926 Number of Sequences: 5004 Number of extensions: 57345 Number of successful extensions: 156 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 153 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 156 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 406444570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -