BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0890 (829 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical pr... 29 4.1 Z75955-6|CAB00120.1| 451|Caenorhabditis elegans Hypothetical pr... 29 5.4 Z66519-5|CAA91382.2| 500|Caenorhabditis elegans Hypothetical pr... 29 5.4 >Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical protein F08H9.1 protein. Length = 607 Score = 29.1 bits (62), Expect = 4.1 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -3 Query: 398 RSPHENIEVLSVVEDSEDFD 339 R+P+ENI++L +DSED D Sbjct: 581 RAPYENIDLLLSTDDSEDID 600 >Z75955-6|CAB00120.1| 451|Caenorhabditis elegans Hypothetical protein R07B7.11 protein. Length = 451 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 Query: 166 PTMFEDIKEIAKEYNIEKSCDKYMNVDVVNSSWRCI 273 P D E+ I K C+ + N D +NSSW+ I Sbjct: 188 PAYLIDHPELVNYNLIGKYCNTWRNFDDINSSWKSI 223 >Z66519-5|CAA91382.2| 500|Caenorhabditis elegans Hypothetical protein B0334.5 protein. Length = 500 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/65 (24%), Positives = 28/65 (43%) Frame = +1 Query: 82 VFTKEPMVNLDMKMKELCIMKLLDHILQPTMFEDIKEIAKEYNIEKSCDKYMNVDVVNSS 261 +F K+ V M+ + ++ HI QP ++ I N+E + + NS Sbjct: 68 LFIKKDQVTPRPIMRRSTQLSIIHHIRQPCQ-SNVPRICDAPNLETTATSTTKLFSWNSQ 126 Query: 262 WRCIR 276 W C+R Sbjct: 127 WTCLR 131 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,838,086 Number of Sequences: 27780 Number of extensions: 333419 Number of successful extensions: 822 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 796 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 822 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2050970610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -