BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0889 (687 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11996| Best HMM Match : FYVE (HMM E-Value=0.004) 40 0.002 SB_27781| Best HMM Match : Ank (HMM E-Value=0) 32 0.38 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 0.41 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.62 SB_9385| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 27 0.88 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 27 0.90 SB_51535| Best HMM Match : W2 (HMM E-Value=4e-29) 31 1.2 SB_59619| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_2108| Best HMM Match : DUF702 (HMM E-Value=4.7) 31 1.2 SB_52187| Best HMM Match : HNF-1A_C (HMM E-Value=1.8) 30 1.5 SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) 30 1.5 SB_4008| Best HMM Match : Fer4 (HMM E-Value=0.16) 30 1.5 SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) 30 1.5 SB_36751| Best HMM Match : Exo_endo_phos (HMM E-Value=2e-12) 30 2.0 SB_28123| Best HMM Match : zf-NF-X1 (HMM E-Value=0.24) 30 2.0 SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_21624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_27160| Best HMM Match : GtrA (HMM E-Value=9.3) 29 2.7 SB_5864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_30900| Best HMM Match : Extensin_2 (HMM E-Value=0.17) 29 3.5 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 29 4.7 SB_27367| Best HMM Match : rve (HMM E-Value=9.5e-17) 29 4.7 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 29 4.7 SB_50357| Best HMM Match : Toxin_8 (HMM E-Value=2.4) 29 4.7 SB_48617| Best HMM Match : Drf_FH1 (HMM E-Value=3.7) 29 4.7 SB_36929| Best HMM Match : rve (HMM E-Value=1.2e-16) 29 4.7 SB_18590| Best HMM Match : FYVE (HMM E-Value=8.8e-29) 29 4.7 SB_2890| Best HMM Match : rve (HMM E-Value=0.044) 29 4.7 SB_33554| Best HMM Match : Sushi (HMM E-Value=0.00055) 28 6.2 SB_23619| Best HMM Match : TPR_1 (HMM E-Value=5.6) 28 6.2 SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_12256| Best HMM Match : TP1 (HMM E-Value=8.5) 28 6.2 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 28 8.1 SB_50061| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_41022| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_39051| Best HMM Match : Gal_Lectin (HMM E-Value=2.5e-21) 28 8.1 SB_10582| Best HMM Match : DUF1168 (HMM E-Value=1.8) 28 8.1 SB_48173| Best HMM Match : WD40 (HMM E-Value=7.3e-18) 28 8.1 SB_42552| Best HMM Match : RhoGAP (HMM E-Value=0) 28 8.1 SB_33496| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_766| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_11996| Best HMM Match : FYVE (HMM E-Value=0.004) Length = 610 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 5/52 (9%) Frame = +1 Query: 115 KMPCESCAVQFSVFRHKRVCGECERYYCSRCLRRG-----GGSMCAPCRVLS 255 +M C C+V F++F+ K C C++ CS C +G C CR L+ Sbjct: 63 EMVCYLCSVNFTLFKRKSTCRGCKKTLCSNCFTQGLNARDQSPRCITCRALA 114 Score = 33.5 bits (73), Expect = 0.16 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +3 Query: 234 CTMPGAVTRPLSRAN-IAHLKVRDLQCFLHRQNVSTRGCVEKEELVGLCVTHVNSPAY 404 C A+ P + + + +LK++DLQ FL +N+ C EK +L+ L + + Y Sbjct: 107 CITCRALAAPSTHKDFLQYLKIKDLQDFLRLKNIPMSQCKEKRDLIELILQYSQPRRY 164 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +3 Query: 279 IAHLKVRDLQCFLHRQNVSTRGCVEKEELV 368 + +L V++L+ L V +GCVEKEEL+ Sbjct: 228 VDNLSVKELKHILTANFVDFKGCVEKEELL 257 >SB_27781| Best HMM Match : Ank (HMM E-Value=0) Length = 485 Score = 32.3 bits (70), Expect = 0.38 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +1 Query: 124 CESCAVQFSVFRHKRVCGECERYYCSRC 207 C C ++FS+ K C C R C++C Sbjct: 429 CHECGMKFSIKNRKHHCRHCGRLLCAKC 456 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 32.3 bits (70), Expect = 0.38 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 103 GRECKMPCESCAVQFSVFRHKRVCGECERYYCSRCL 210 G+EC + C +C + H C +C RY+C CL Sbjct: 90 GKECDIKC-ACKNRLIAIAH---CFDCSRYFCENCL 121 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 25.8 bits (54), Expect(2) = 0.41 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +2 Query: 515 PYPAPPPPTRSCHNNSH--SHV 574 P P PPPP + H+ H SHV Sbjct: 112 PPPPPPPPPITLHHEQHVVSHV 133 Score = 25.0 bits (52), Expect(2) = 0.41 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 497 PETCSQPYPAPPPP 538 P C+ P P PPPP Sbjct: 97 PACCAPPPPPPPPP 110 Score = 24.6 bits (51), Expect(2) = 5.6 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 497 PETCSQPYPAPPPP 538 P C P P PPPP Sbjct: 96 PPACCAPPPPPPPP 109 Score = 22.2 bits (45), Expect(2) = 5.6 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 515 PYPAPPPPTRSCHNNSH 565 P P PPPP C H Sbjct: 138 PPPPPPPPPAPCMPPCH 154 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 28.7 bits (61), Expect(2) = 0.62 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = +2 Query: 515 PYPA-PPPPTRSCHNNSHSHVPGQPTSDRLTTSGSRXPGXXPPRSERFXTTPG 670 P P+ PPPP S S PG P TS PP + PG Sbjct: 701 PQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPPPGQLPGQQPG 753 Score = 21.4 bits (43), Expect(2) = 0.62 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 485 LDVQPETCSQPYPAPPPP 538 L + +T P P PPPP Sbjct: 674 LPIPIQTMVPPPPPPPPP 691 >SB_9385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 608 Score = 31.1 bits (67), Expect = 0.87 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 Query: 124 CESCAVQFSVFRHKRVCGECERYYCSRC 207 C C+ +F+ R K C +C R C++C Sbjct: 48 CPLCSQKFTQIRRKHHCRQCGRVLCNKC 75 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 27.1 bits (57), Expect(2) = 0.88 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 515 PYPAPPPPTRSCHNNSHSHVPGQPTSDRLTTSGSRXP 625 P APPPP R N G P S+ TT G P Sbjct: 266 PKNAPPPPKRGSSNPPPPPTRG-PPSNSFTTQGPPLP 301 Score = 22.6 bits (46), Expect(2) = 0.88 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 497 PETCSQPYPAPPP 535 P S+P PAPPP Sbjct: 233 PTGSSRPLPAPPP 245 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 27.1 bits (57), Expect(2) = 0.90 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 515 PYPAPPPPTRSCHNNSHSHVPGQPTSDRLTTSGSRXP 625 P APPPP R N G P S+ TT G P Sbjct: 178 PKNAPPPPKRGSSNPPPPPTRG-PPSNSFTTQGPPLP 213 Score = 22.6 bits (46), Expect(2) = 0.90 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 497 PETCSQPYPAPPP 535 P S+P PAPPP Sbjct: 145 PTGSSRPLPAPPP 157 >SB_51535| Best HMM Match : W2 (HMM E-Value=4e-29) Length = 770 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/44 (40%), Positives = 21/44 (47%) Frame = +2 Query: 530 PPPTRSCHNNSHSHVPGQPTSDRLTTSGSRXPGXXPPRSERFXT 661 PP T S ++ H H G P S R GSR P PPR + T Sbjct: 351 PPLTGSPPSSRHPHYGGSPPSSRNQQYGSRRP---PPRPIQLNT 391 >SB_59619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 448 Score = 30.7 bits (66), Expect = 1.2 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Frame = +2 Query: 407 ASELSQ*EQSIQFS*RXNSQHQ*VHKLDVQPETCSQPYPAPPPPTR--SCHNNSHSHVPG 580 AS S+ EQ + S S H + K+ P+ CS P P PP R H + S G Sbjct: 213 ASTDSEPEQGRRISQTTRSAHLSLRKMTSMPDGCSGPKPRPPLKKRFSEIHRRTSSDSLG 272 Query: 581 QPTSD 595 T++ Sbjct: 273 VSTAN 277 >SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 124 CESCAVQFSVFRHKRVCGECERYYCSRC 207 C SC +FS K C C R +C C Sbjct: 947 CTSCKAEFSFLLRKHHCRMCGRIFCHSC 974 >SB_2108| Best HMM Match : DUF702 (HMM E-Value=4.7) Length = 297 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = +2 Query: 503 TCSQPYPAPPPP--TRSCHNNSH 565 +C Q APPPP +SCH+N+H Sbjct: 271 SCPQRIAAPPPPYALQSCHSNAH 293 >SB_52187| Best HMM Match : HNF-1A_C (HMM E-Value=1.8) Length = 193 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 6/57 (10%) Frame = +2 Query: 512 QPYPAPPPPTRSCHNNSHSHVPGQPTSDRLTTSG------SRXPGXXPPRSERFXTT 664 QP+ P P + H S++H+P Q S ++T+ ++ P PP R +T Sbjct: 91 QPFTKPSAPLQYVHRESNTHLPSQRISLPVSTNAYLHYHQTKKPSTKPPHHTRKHST 147 >SB_6686| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 2411 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Frame = +1 Query: 109 ECKMPCESCAVQFSVFRHKR-VCGECERYYC---SRCLRRGGGSMC 234 EC M +C+ + SV + K C C+ C S+C RR GG+ C Sbjct: 908 ECVMRALACSRKESVNKTKDGACDPCQLVSCRFYSKCQRRRGGAQC 953 >SB_4008| Best HMM Match : Fer4 (HMM E-Value=0.16) Length = 444 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 Query: 312 FLHRQNVSTRGCVEKEELVGLCVTHVNSPAYRRR 413 F H N + +GC+ + VG C VN P +R R Sbjct: 84 FSHEVNHAMQGCLACKSCVGQCPIKVNVPEFRSR 117 >SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) Length = 892 Score = 30.3 bits (65), Expect = 1.5 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +1 Query: 124 CESCAVQFSVFRHKRVCGECERYYCSRC 207 C C V+F F + C C + +C +C Sbjct: 233 CHMCRVKFGTFIRQHHCRNCGQVFCKKC 260 >SB_36751| Best HMM Match : Exo_endo_phos (HMM E-Value=2e-12) Length = 906 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 586 WLPRNVRVTIVVTATCRRWWCWIWL 512 WL V +VVT+ C +W+C WL Sbjct: 585 WLSPVVLSPVVVTSGCHQWFCHQWL 609 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 586 WLPRNVRVTIVVTATCRRWWCWIWL 512 WL R V + VT+ C W+C WL Sbjct: 669 WLSRVVVTSGFVTSGCHEWFCHQWL 693 >SB_28123| Best HMM Match : zf-NF-X1 (HMM E-Value=0.24) Length = 453 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = +1 Query: 100 CGRECKMPC-ESCAVQFSVFRHKRVCGE-CERYYCSRCLRRGGGSMCAPCRVLSPVHYPE 273 CG C +PC E CA + ++ ++CGE C+R C + PC L PE Sbjct: 68 CGEPC-VPCAEPCAWKCRHYKCSKLCGEICDRPRCDKPCPYKIEKCKHPCIGLCGEKCPE 126 Query: 274 QTSLTSK 294 + + K Sbjct: 127 KCRICDK 133 >SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2077 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 100 CGRECKMPC-ESCAVQFSVFRHKRVCGE-CERYYCSR 204 CG C +PC E CA + ++ ++CGE C+R C + Sbjct: 1963 CGEPC-VPCAEPCAWECRHYKCNKLCGEMCDRPRCDK 1998 >SB_21624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.5 bits (63), Expect = 2.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 568 RVTIVVTATCRRWWCW 521 ++T++VT CR WW W Sbjct: 129 KLTLIVTNLCRYWWTW 144 >SB_27160| Best HMM Match : GtrA (HMM E-Value=9.3) Length = 398 Score = 29.5 bits (63), Expect = 2.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -3 Query: 568 RVTIVVTATCRRWWCW 521 ++T++VT CR WW W Sbjct: 376 KLTLIVTNLCRYWWTW 391 >SB_5864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = +1 Query: 124 CESCAVQFSV----FRHKRVCGECERYYCSRC 207 CE+C QF V RHKR+ C+ + C C Sbjct: 188 CETCGKQFRVTSDLIRHKRIHTGCKPFLCEVC 219 >SB_30900| Best HMM Match : Extensin_2 (HMM E-Value=0.17) Length = 473 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/59 (28%), Positives = 22/59 (37%), Gaps = 8/59 (13%) Frame = +2 Query: 488 DVQPETCSQPYPAPPPPTRSCHNNSHSH----VPGQPTSDRLTTS----GSRXPGXXPP 640 D + C P P PP P + + H H P PT+ +T R P PP Sbjct: 332 DTRHHHCRHPAPPPPTPGTTTADTRHHHRRHPAPSPPTTGTITADTRHHHRRHPAPSPP 390 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +2 Query: 497 PETCSQPYPAPPPPTRSCHNNS---HSHVPGQPTS 592 P TC YP PP P C HS VP P++ Sbjct: 256 PSTCIPLYPVPPVPAFHCTQYPQYLHSIVPSTPST 290 >SB_27367| Best HMM Match : rve (HMM E-Value=9.5e-17) Length = 1590 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +2 Query: 500 ETCSQPYPAPPPPTRSCHNNSH----SHVPGQPTSDRLTTS 610 +T S AP PP+++CH+ + + PG PT D T + Sbjct: 1494 KTPSMAPDAPSPPSQTCHHTNRTATPATTPGVPTPDLATAA 1534 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +2 Query: 497 PETCSQPYPAPPPPTRSCHNNS---HSHVPGQPTS 592 P TC YP PP P C HS VP P++ Sbjct: 86 PSTCIPLYPVPPVPAFHCTQYPQYLHSIVPSAPST 120 >SB_50357| Best HMM Match : Toxin_8 (HMM E-Value=2.4) Length = 304 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/54 (27%), Positives = 30/54 (55%) Frame = +2 Query: 458 NSQHQ*VHKLDVQPETCSQPYPAPPPPTRSCHNNSHSHVPGQPTSDRLTTSGSR 619 N+ + + +L ++ E+C++ + P PP+ HS P +PT + +TS +R Sbjct: 99 NNNSKILQQLSLEKESCNKSF-TPRPPSTPPSPRKHSR-PCRPTRSQSSTSRAR 150 >SB_48617| Best HMM Match : Drf_FH1 (HMM E-Value=3.7) Length = 477 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +2 Query: 500 ETCSQPYPAPPPPTRSCHNNSH----SHVPGQPTSDRLTTS 610 +T S AP PP+++CH+ + + PG PT D T + Sbjct: 204 KTPSMAPAAPSPPSQTCHHTNRTATPATTPGVPTPDLATAA 244 >SB_36929| Best HMM Match : rve (HMM E-Value=1.2e-16) Length = 913 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +2 Query: 500 ETCSQPYPAPPPPTRSCHNNSH----SHVPGQPTSDRLTTS 610 +T S AP PP+++CH+ + + PG PT D T + Sbjct: 828 KTPSMAPAAPSPPSQTCHHTNRTATPATTPGVPTPDLATAA 868 >SB_18590| Best HMM Match : FYVE (HMM E-Value=8.8e-29) Length = 551 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +1 Query: 124 CESCAVQFSVFRHKRVCGECERYYCSRC 207 C SC FS+ K C C +CS C Sbjct: 361 CNSCDKVFSITLRKHHCRNCGLIFCSDC 388 >SB_2890| Best HMM Match : rve (HMM E-Value=0.044) Length = 336 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +2 Query: 500 ETCSQPYPAPPPPTRSCHNNSH----SHVPGQPTSDRLTTS 610 +T S AP PP+++CH+ + + PG PT D T + Sbjct: 240 KTPSMAPAAPSPPSQTCHHTNRTATPATTPGVPTPDLATAA 280 >SB_33554| Best HMM Match : Sushi (HMM E-Value=0.00055) Length = 685 Score = 28.3 bits (60), Expect = 6.2 Identities = 21/88 (23%), Positives = 35/88 (39%), Gaps = 1/88 (1%) Frame = +2 Query: 89 KCLFVDVNARCRAKAVRYSSACLDTKEFVVNVRGTTAADASVAVEAPCVHHAGC-CHPST 265 KC + N R R + +Y+ +DT+++ T D + V AP HA P Sbjct: 451 KCTYRQANTRSRTQTYKYTCTQIDTRKYTY-----THPDTHMHVHAP--RHANTRGAPRH 503 Query: 266 IPSKHRSPQSSRPSVLPTSSKRIHQRMC 349 ++ R+ P + +H R C Sbjct: 504 AYARTRTQTHKYMYTHPDTQMHVHTRKC 531 >SB_23619| Best HMM Match : TPR_1 (HMM E-Value=5.6) Length = 71 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 438 MDCSHCESSDAGMQDYLHVLHTDPPTLPFR 349 MD H + + G +DYL LH DP L R Sbjct: 34 MDFGHEQGNVLGRRDYLKALHLDPLCLSAR 63 >SB_14256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3176 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 521 PAPPPPTRSCHNNSHSHVPGQPTSDRLTTSGS 616 P+P P + ++S S P PTS L T GS Sbjct: 3049 PSPESPNQESEDDSVSPAPPWPTSHSLNTMGS 3080 >SB_12256| Best HMM Match : TP1 (HMM E-Value=8.5) Length = 156 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 375 CVTHVNSPAYRRRS-SRNENSPFSSLKGLTVNINEFI 482 C + P RR S SRN NSP +++ L ++ + FI Sbjct: 117 CSKQLGRPRIRRESASRNYNSPLQAMEILNLSCSRFI 153 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 Query: 375 TDPPTLPFRHILWWIRFDDVG 313 T PP P RH L W RF G Sbjct: 160 TPPPLRPLRHNLLWSRFSSYG 180 >SB_50061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1222 Score = 27.9 bits (59), Expect = 8.1 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 4/33 (12%) Frame = +2 Query: 524 APPPPTRSCHNNSH----SHVPGQPTSDRLTTS 610 AP PP+++CH+ + + PG PT D T + Sbjct: 1134 APSPPSQTCHHTNRTATPATTPGVPTPDLATAA 1166 >SB_41022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 580 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +2 Query: 506 CSQPYPAPPP-PTRSCHNNSHSHVPGQPTSDRLT---TSGSRXPGXXPPRSERFXT 661 C P P PPP TR C+ N + P +D T T+G+R PR+ T Sbjct: 308 CEPPVPDPPPSETRECNRNP-CNPPTTLGTDHTTPSNTTGNRTKVPTTPRTSEGET 362 >SB_39051| Best HMM Match : Gal_Lectin (HMM E-Value=2.5e-21) Length = 1405 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/47 (29%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 503 TCSQPYPAPPPPT-RSCHNNSHSHVPGQPTSDRLTTSGSRXPGXXPP 640 +C Q APPP +S H+N+H P P PP Sbjct: 487 SCPQRIAAPPPHALQSYHSNAHQRTTRDPRGPYRNPESMPHPRQYPP 533 >SB_10582| Best HMM Match : DUF1168 (HMM E-Value=1.8) Length = 454 Score = 27.9 bits (59), Expect = 8.1 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +2 Query: 515 PYPAPPPPTRSCHNNSHSHVPGQPTSDRLT--TSGSRXPGXXPPRSERFXTTPG 670 P PA PP S++ +P +P S + T G P PPR +R +PG Sbjct: 112 PPPADVPPV-CLPVVSNTSLPNEPQSTEVVKNTVGDPPPPVAPPRRKRKKKSPG 164 >SB_48173| Best HMM Match : WD40 (HMM E-Value=7.3e-18) Length = 659 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/60 (26%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 494 QPETCSQPYPAPPPPTRSCHNNSHSHVPGQPTSDRLTTSGSRXP-GXXPPRSERFXTTPG 670 QP++ P P P R + + S +P S ++ T P PP++E F G Sbjct: 295 QPQSTPAPATTGPSPVRLVGSRAMSEIPPPIGSVKIPTKTEAAPAASSPPKNEPFEDALG 354 >SB_42552| Best HMM Match : RhoGAP (HMM E-Value=0) Length = 945 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +2 Query: 191 TTAADASVAVEAPCVHHAGCCHPSTIPSKHRSPQSSRPSVLPTSS 325 TTA+ +++ V H+G HPS S S+ V+PT++ Sbjct: 712 TTASPSAIGVVHSSAMHSGVTHPSVTHSGVTPTGSTTIGVIPTAT 756 >SB_33496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1082 Score = 27.9 bits (59), Expect = 8.1 Identities = 24/83 (28%), Positives = 36/83 (43%) Frame = +2 Query: 404 PASELSQ*EQSIQFS*RXNSQHQ*VHKLDVQPETCSQPYPAPPPPTRSCHNNSHSHVPGQ 583 P E S+ +QS S NS K+ V S P+ +S HN+SH + PG+ Sbjct: 881 PFVEASRCDQSQHNSSHGNSPG----KVQVNTSGQSSPFVEASRGDQSQHNSSHGNSPGK 936 Query: 584 PTSDRLTTSGSRXPGXXPPRSER 652 ++ TSG P R ++ Sbjct: 937 A---QVNTSGQSSPFVEASRGDQ 956 >SB_766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1704 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +2 Query: 467 HQ*VHKLDVQPETCSQPYPAPPPPTRSCHNNSHSHV 574 H+ H+L +P C PYP P + N+ +H+ Sbjct: 1008 HERKHELQDKPYKCECPYPRRPETRENYFNSLLAHI 1043 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,464,983 Number of Sequences: 59808 Number of extensions: 505376 Number of successful extensions: 2297 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 1818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2262 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -