BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0889 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 25 2.2 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 25 3.0 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 25 3.0 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 25 3.0 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 3.9 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 24 5.2 DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protei... 24 5.2 DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protei... 24 5.2 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 24 5.2 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 24 5.2 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 6.8 AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. 23 6.8 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 23 6.8 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 23 6.8 AJ439060-2|CAD27753.1| 135|Anopheles gambiae putative cytoskele... 23 6.8 AJ438610-10|CAD27482.1| 135|Anopheles gambiae putative cytoskel... 23 6.8 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 23 9.0 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 9.0 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 9.0 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 9.0 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 25.0 bits (52), Expect = 2.2 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 7/72 (9%) Frame = +3 Query: 99 LWT*MQDAVRKLCGTVQRV*TQK---SLW*M*EVLLQ--QMPPSRWR--LHVCTMPGAVT 257 +W DAV KLC T+ + +LW EV+ +PP ++ LH + G Sbjct: 113 IWKERDDAVAKLCRTMDVRCVENVSHTLWNPIEVIQTNGDIPPLTYQMFLHTVNIIGDPP 172 Query: 258 RPLSRANIAHLK 293 RP+ N +++ Sbjct: 173 RPVGAPNFEYVE 184 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 248 CCHPSTIPSKHRSPQSSRPSVLPTSSKRIHQRMC 349 C +PS RS SS+P+ S+K + + C Sbjct: 126 CLPLGILPSNQRSSSSSKPTPCWESNKDVFPKPC 159 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 248 CCHPSTIPSKHRSPQSSRPSVLPTSSKRIHQRMC 349 C +PS RS SS+P+ S+K + + C Sbjct: 126 CLPLGILPSNQRSSSSSKPTPCWESNKDVFPKPC 159 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 248 CCHPSTIPSKHRSPQSSRPSVLPTSSKRIHQRMC 349 C +PS RS SS+P+ S+K + + C Sbjct: 126 CLPLGILPSNQRSSSSSKPTPCWESNKDVFPKPC 159 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 24.2 bits (50), Expect = 3.9 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 654 KRSER-GGXXPGCRLPDVVRRS 592 +RS R GG P CR P RRS Sbjct: 259 RRSPRSGGRWPSCRSPPARRRS 280 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.8 bits (49), Expect = 5.2 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 509 SQPYPAPPPP 538 +QP PAPPPP Sbjct: 579 AQPPPAPPPP 588 >DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/26 (38%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +1 Query: 178 ECERYYCSRC--LRRGGGSMCAPCRV 249 +C+ Y+C RC + S CA C V Sbjct: 261 KCKHYFCERCALAQYKKSSRCAICGV 286 >DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/26 (38%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +1 Query: 178 ECERYYCSRC--LRRGGGSMCAPCRV 249 +C+ Y+C RC + S CA C V Sbjct: 261 KCKHYFCERCALAQYKKSSRCAICGV 286 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.8 bits (49), Expect = 5.2 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 494 QPETCSQPYPAPPPPTRSCHNNSHSHVPGQPTSDRLTTSG 613 +PET + P P S +S + P PTS R+T G Sbjct: 1110 RPETPAFPVTPRTPYGLSNGTSSPALPPKSPTSQRITLPG 1149 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.8 bits (49), Expect = 5.2 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +2 Query: 512 QPYPAPPPPTRSCHNNSHSHVPGQPTSDRLTTSGSR-XPGXXPP 640 QP PPP T S S P +DR + SR P PP Sbjct: 638 QPPVVPPPRTNSQSQASEPTPALPPRADRDSKPSSRDRPKDLPP 681 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +2 Query: 488 DVQPETCSQPYPAPPPPTRSCHNNSHSHVPG 580 D +P + +P PPPP + ++S + G Sbjct: 667 DSKPSSRDRPKDLPPPPIPASGSSSTGNTTG 697 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 6.8 Identities = 13/50 (26%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +1 Query: 145 FSVFRHKRVCGECER-YYCSRCLRRGGGSMCAPCRVLSPVHYPEQTSLTS 291 F+ R EC Y C +C R+ +C R+ P + LT+ Sbjct: 378 FNCLRKGHSARECRSTYVCQQCKRKHHSKLCKIGRLSEVEVVPSTSRLTA 427 >AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. Length = 165 Score = 23.4 bits (48), Expect = 6.8 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +2 Query: 509 SQPYPAPPPPTRSCHNNSHSHVPGQPTSDRLT 604 S PY APP P S + H +S+ T Sbjct: 69 SSPYHAPPSPANSHYEPMECHSAVNSSSNSST 100 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 155 LDTKEFVVNVRGTTAADASVAVE 223 +DTK +N GT + D AVE Sbjct: 153 VDTKTLAINESGTASFDVMPAVE 175 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 257 GDSTRHGAHMEPPPRRRH 204 G + RH PPPRRRH Sbjct: 328 GAAERH-RRRRPPPRRRH 344 >AJ439060-2|CAD27753.1| 135|Anopheles gambiae putative cytoskeletal regulator protein. Length = 135 Score = 23.4 bits (48), Expect = 6.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 378 VTHVNSPAYRRRSSRNENSPFSSLKGLTVNINEFISST 491 V V +P Y RSS+ P+++ + V NEF + T Sbjct: 4 VKRVVTPKYIARSSKLALQPYAAAPTIPVADNEFEALT 41 >AJ438610-10|CAD27482.1| 135|Anopheles gambiae putative cytoskeletal regulator protein. Length = 135 Score = 23.4 bits (48), Expect = 6.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 378 VTHVNSPAYRRRSSRNENSPFSSLKGLTVNINEFISST 491 V V +P Y RSS+ P+++ + V NEF + T Sbjct: 4 VKRVVTPKYIARSSKLALQPYAAAPTIPVADNEFEALT 41 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 Query: 103 HKQTLIIPISNGFTGLYLNIN 41 ++Q +P S GF GLY+ +N Sbjct: 67 YEQYKAVPGSPGFVGLYIFLN 87 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/41 (26%), Positives = 16/41 (39%) Frame = +2 Query: 524 APPPPTRSCHNNSHSHVPGQPTSDRLTTSGSRXPGXXPPRS 646 AP P + N ++ G P + R + G PP S Sbjct: 308 APGGPPQGMRPNFYNRPMGDPQTSRPPSGNDNMGGGPPPSS 348 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.0 bits (47), Expect = 9.0 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +2 Query: 536 PTRSCHNNSHSHVPGQPTSDRLTTSGSRXPG 628 P+ + + HSH P + T GS PG Sbjct: 362 PSSNSLSTQHSHSPVNGYGNNHPTGGSNLPG 392 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 366 PTLPFRHILWWIRFDDVGSTEGREL*GERC 277 P +P + L + FD VGS GE+C Sbjct: 1463 PNMPKLNFLNVLNFDKVGSMNWELAYGEKC 1492 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 739,613 Number of Sequences: 2352 Number of extensions: 15892 Number of successful extensions: 60 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -