BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0888 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38165| Best HMM Match : Drf_FH1 (HMM E-Value=1) 29 2.5 SB_52178| Best HMM Match : Drf_FH1 (HMM E-Value=2.2) 28 5.7 SB_47033| Best HMM Match : WAP (HMM E-Value=1.8e-38) 28 7.6 >SB_38165| Best HMM Match : Drf_FH1 (HMM E-Value=1) Length = 231 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +3 Query: 75 YMPTEPQSPTPN--SKTIFTTASSLPITTMPLKKANRSTRTRRAKSSQMS*TNSYETT 242 Y PT +PTP+ S T +T+ +S TT + ++ T ++ + T SY +T Sbjct: 134 YTPTTSYTPTPSYTSTTSYTSTTSYTSTTSYTSTPSYTSTTSYTSTTSYTSTTSYTST 191 >SB_52178| Best HMM Match : Drf_FH1 (HMM E-Value=2.2) Length = 404 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +3 Query: 84 TEPQSPTPNSKTIFTTASSLPITTMP--LKKANRSTRTRRAKSSQ 212 T P PTP K + +++P+T +P K + +T+ AK S+ Sbjct: 244 TAPPKPTPPPKPAPSLKTTIPLTDVPPLTSKEKKHEKTKTAKPSK 288 >SB_47033| Best HMM Match : WAP (HMM E-Value=1.8e-38) Length = 667 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 5/61 (8%) Frame = +3 Query: 78 MPTEPQSPTPNSKTIFT-----TASSLPITTMPLKKANRSTRTRRAKSSQMS*TNSYETT 242 +PT ++PTP ++ +FT TA +P T + T R + Q+ T TT Sbjct: 181 LPTSKRTPTPATEPVFTTQRTPTAKQVPTTERIPTSEQKPTTKRVPTTGQIQATPEMPTT 240 Query: 243 R 245 + Sbjct: 241 K 241 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,194,655 Number of Sequences: 59808 Number of extensions: 211250 Number of successful extensions: 687 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -