BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0887 (744 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 0.48 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 23 2.6 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 2.6 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 3.4 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 4.5 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 4.5 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 6.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.4 bits (53), Expect = 0.48 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -2 Query: 614 EGHPEHEGILGHPDFGRSVVQEQSDET 534 +G P+ + +LG P FGRS + ++ET Sbjct: 406 KGFPKSKIVLGVPFFGRSFTLQFTNET 432 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 605 GGLHSADSLSHRDGVLSRRETXSSDELHIPGP 700 G +ADS SH DG + S L GP Sbjct: 53 GARSNADSTSHTDGASTPDVRPPSSSLSYGGP 84 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 605 GGLHSADSLSHRDGVLSRRETXSSDELHIPGP 700 G +ADS SH DG + S L GP Sbjct: 209 GARSNADSTSHTDGASTPDVRPPSSSLSYGGP 240 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -2 Query: 635 ETDYQHYEGHPEHEGILGHPDFGRS-VVQEQSD 540 + Y G P + +LG P FGR+ + ++SD Sbjct: 279 QVKYWMSNGAPSAKIVLGLPTFGRAWAMDDESD 311 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 531 SSPSADTSDRVHLSDESP 478 SSPS+DTS + S +SP Sbjct: 66 SSPSSDTSQDLQHSYQSP 83 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 22.2 bits (45), Expect = 4.5 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -2 Query: 125 VKIPLTISRCSNFYTMNFTIDSLDKHNL 42 VKIPL I SN + LDK N+ Sbjct: 447 VKIPLVIIWSSNLSKRPYIYKYLDKKNV 474 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.8 bits (44), Expect = 6.0 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 4/33 (12%) Frame = -2 Query: 647 RHRDETDYQ-HY---EGHPEHEGILGHPDFGRS 561 ++ + DYQ Y +G P ++ ILG P +GR+ Sbjct: 263 KYDENVDYQVRYWLQKGAPNNKLILGIPAYGRA 295 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,362 Number of Sequences: 336 Number of extensions: 3594 Number of successful extensions: 19 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -