BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0886 (703 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC11B10.01 |alg2|SPBC32H8.14|mannosyltransferase complex subun... 27 3.4 SPAPB1A10.15 |||Arv1-like family protein|Schizosaccharomyces pom... 26 6.0 >SPBC11B10.01 |alg2|SPBC32H8.14|mannosyltransferase complex subunit Alg2|Schizosaccharomyces pombe|chr 2|||Manual Length = 511 Score = 26.6 bits (56), Expect = 3.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 663 FEYAICVLSASFLTFSIT*KLT 598 F C++S SFLTF++ KLT Sbjct: 488 FMLGTCIVSVSFLTFTVYAKLT 509 >SPAPB1A10.15 |||Arv1-like family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 220 Score = 25.8 bits (54), Expect = 6.0 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -3 Query: 98 RXHLVNVLASEPTQRTTK-AKIINFCISIVSF 6 R L N L++ + TK AK++NFCI I F Sbjct: 60 RHLLFNSLSARTFRNLTKCAKVVNFCILISLF 91 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,482,629 Number of Sequences: 5004 Number of extensions: 45289 Number of successful extensions: 110 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -