BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0878 (740 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 2.0 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 2.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.6 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.6 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 21 7.9 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/49 (22%), Positives = 25/49 (51%) Frame = -3 Query: 714 VEIDDSTSIIEGLVYHVXNNWEQLIPASWPHTSLAGGYLQ*DETPPWEQ 568 ++ D +++ + G NN++Q++ PHT+ G Q + P ++ Sbjct: 2 IDKDMNSACMRGGSVRTLNNYQQVMEPRSPHTAWQFGVSQIVKREPMDE 50 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.0 bits (47), Expect = 2.6 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 699 YHRFPHWGFAN 731 YH+ PH+GF N Sbjct: 442 YHKDPHYGFHN 452 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 137 RXWHCLGH*RQL*HHGMLRAERR 69 R WH LG Q ++ + R ER+ Sbjct: 515 RRWHALGREEQAKYYELARRERQ 537 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 137 RXWHCLGH*RQL*HHGMLRAERR 69 R WH LG Q ++ + R ER+ Sbjct: 407 RRWHALGREEQAKYYELARRERQ 429 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/47 (23%), Positives = 21/47 (44%) Frame = -3 Query: 705 DDSTSIIEGLVYHVXNNWEQLIPASWPHTSLAGGYLQ*DETPPWEQL 565 +D + + L+ H N W +L PH + +L + P E++ Sbjct: 79 EDVHKVFQHLMIHRPNWWHELETKFNPHHEIKLQHLHQSKFNPHEEV 125 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,473 Number of Sequences: 336 Number of extensions: 3741 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -