BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0874 (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 4.2 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 24 5.6 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 24 5.6 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 23 7.4 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 23 9.7 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.2 bits (50), Expect = 4.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 334 WSLRPCDLEVKLLRDSRTVYSALAKEVDDYAGWIN 438 W LRP L + L + R ++ K+ +Y WI+ Sbjct: 248 WQLRPHVLTERNLEEFRCKWNNWTKQRRNYGTWIS 282 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.8 bits (49), Expect = 5.6 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 437 TMEACSYQEARFVHKSIYVFILWVSNGNPQ*SVGP 541 T A ++ + V + I+V I W+S Q ++GP Sbjct: 498 TTAAIAFGDKLNVKEKIFVAISWMSKATVQAALGP 532 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -1 Query: 127 ITCSYPNAAVSYDFEHFFRNTKSNTRSLP 41 +T P+ YDF ++R T N +LP Sbjct: 87 LTGRRPDTVRLYDFYSYWRQTSGNYTTLP 115 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 23.4 bits (48), Expect = 7.4 Identities = 8/30 (26%), Positives = 19/30 (63%) Frame = +1 Query: 586 SKWLFTQRKTVLSIRRWLAVRLSRLLRRTV 675 ++W+ Q V+ +++ + VRL R +R ++ Sbjct: 438 ARWVAIQGNPVVRVQKTVLVRLDRSVRHSI 467 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 23.0 bits (47), Expect = 9.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 Query: 341 RDHTIPAVCHVVP 303 RD+T+P HV+P Sbjct: 386 RDYTVPGTKHVIP 398 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 792,731 Number of Sequences: 2352 Number of extensions: 16102 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -