BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0871 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 23 2.9 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 21 9.0 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 9.0 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = -1 Query: 402 GEYPGAMTPSDTSLEMMVAVLTSQGSESATKSPKELMRSAPR 277 G P +TP+ T+++ ++ + +E T P + PR Sbjct: 154 GSLPTPVTPTPTTVQQLLRRAQIRRNERRTPDPHDETAKKPR 195 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.4 bits (43), Expect = 9.0 Identities = 11/34 (32%), Positives = 12/34 (35%) Frame = +3 Query: 105 AWQLVKELKEALSLPAAASFKHVSPAGAAVGLPL 206 AW S PA FK VS LP+ Sbjct: 28 AWWFWTATSHEASAPAEGKFKTVSKVPGPFSLPI 61 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 723 VECATCCPAPMP 688 VE +CCP P P Sbjct: 190 VEYYSCCPEPYP 201 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,965 Number of Sequences: 438 Number of extensions: 3155 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -