BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0869 (638 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0056 + 17693332-17693603,17694298-17694520,17695420-176956... 29 3.1 01_05_0747 - 24857965-24858393,24858502-24860063,24860176-24860245 28 5.4 >01_05_0056 + 17693332-17693603,17694298-17694520,17695420-17695668, 17695771-17695824 Length = 265 Score = 29.1 bits (62), Expect = 3.1 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 3/75 (4%) Frame = -3 Query: 234 AGKLVTSVEFCFFIKSMMVCSISVALVRLYIIPESVLVHTKGTRISK---CTCKCHNVCT 64 AG L+ + F F + CS VAL +L +IP S G+ I T + C+ Sbjct: 185 AGGLIIGLTFVFVGLLTVECSFDVALRQLLVIPISATAGLLGSLIDSVLGATLQFSGYCS 244 Query: 63 FRGTGNSVI*SEIDP 19 R +I DP Sbjct: 245 VRKKVLPLIAQRFDP 259 >01_05_0747 - 24857965-24858393,24858502-24860063,24860176-24860245 Length = 686 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = -3 Query: 261 LQSISSLNPAGKLVTSVEFCFFIKSMMVCSISVALVRLYIIPESVLVHTKGT 106 L I+++ AG LVT++ F +K + +S+A+ R +L H + + Sbjct: 593 LSGIATVTVAGLLVTTMFHAFVLKDLFPNDVSIAITRKKPKFSKILAHFRSS 644 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,639,015 Number of Sequences: 37544 Number of extensions: 278744 Number of successful extensions: 572 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 572 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1573040476 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -