BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0869 (638 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylch... 24 3.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 3.5 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 24 4.7 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 24 4.7 >AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 9 protein. Length = 406 Score = 24.2 bits (50), Expect = 3.5 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +2 Query: 314 TDPIIISLHLSSQWXYGIQLLLAGTEKYQCCFXPXIRTEY 433 ++P I +L +S+W + T Y CC P I Y Sbjct: 196 SEPQIETLVSNSEWKIAKISVERNTRYYPCCTEPYIDITY 235 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.2 bits (50), Expect = 3.5 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = +2 Query: 194 MKKQNSTDVT---NFPAGFSDDMDWSDVMTSTD 283 +K+ NS + N F +D+DWS++ S+D Sbjct: 419 LKRVNSGSIVILENSDLCFVEDIDWSEIKKSSD 451 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/42 (26%), Positives = 19/42 (45%) Frame = +1 Query: 256 LERCYDIYGCFSKAYPWTEHRPDNYFPASVESMAIRYPTFTR 381 L+ YD++G + + + FP+ ES+ Y TR Sbjct: 168 LQVAYDLFGMLAVSQSTLQSLAGGCFPSGEESLCFFYSFVTR 209 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.8 bits (49), Expect = 4.7 Identities = 11/42 (26%), Positives = 19/42 (45%) Frame = +1 Query: 256 LERCYDIYGCFSKAYPWTEHRPDNYFPASVESMAIRYPTFTR 381 L+ YD++G + + + FP+ ES+ Y TR Sbjct: 168 LQVAYDLFGMLAVSQSTLQSLAGGCFPSGEESLCFFYSFVTR 209 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 619,071 Number of Sequences: 2352 Number of extensions: 11757 Number of successful extensions: 27 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -