BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0869 (638 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81460-5|CAB03832.1| 952|Caenorhabditis elegans Hypothetical pr... 28 4.9 Z70209-3|CAA94147.1| 952|Caenorhabditis elegans Hypothetical pr... 28 4.9 Z81502-2|CAB04106.2| 720|Caenorhabditis elegans Hypothetical pr... 28 6.5 >Z81460-5|CAB03832.1| 952|Caenorhabditis elegans Hypothetical protein C04A11.4 protein. Length = 952 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 114 KGTRISKCTCKCHNVCTFRGTGNSV 40 K +ISK T +C + C FRG N+V Sbjct: 613 KKEKISKVTAQCLDNCNFRGVCNNV 637 >Z70209-3|CAA94147.1| 952|Caenorhabditis elegans Hypothetical protein C04A11.4 protein. Length = 952 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 114 KGTRISKCTCKCHNVCTFRGTGNSV 40 K +ISK T +C + C FRG N+V Sbjct: 613 KKEKISKVTAQCLDNCNFRGVCNNV 637 >Z81502-2|CAB04106.2| 720|Caenorhabditis elegans Hypothetical protein F14B6.2 protein. Length = 720 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +2 Query: 188 LLMKKQNSTDVTNFPAGFSDDMDWSDVMTSTDVFLKPTRGRSTDP 322 + +K + + P DD +DV+ D KP GRST P Sbjct: 92 IAFEKSDPRKFSKIPDDDDDDNSKTDVINKKDKKKKPLYGRSTSP 136 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,160,788 Number of Sequences: 27780 Number of extensions: 242730 Number of successful extensions: 653 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -