BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0866 (777 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 28 0.37 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 28 0.37 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 2.3 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 23 8.0 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 27.9 bits (59), Expect = 0.37 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +1 Query: 70 MREIVHLQAGQCGNQIGAKFWE-IISXRARHRPHRC 174 MRE + + GQ G QIG W+ + A +R RC Sbjct: 1 MRECISVHVGQAGVQIGNPCWDCTVWSMASNRTVRC 36 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 27.9 bits (59), Expect = 0.37 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 381 PELFRKTKVCSGRKESVRKGSRSRYRSSMVPGLQVRTRMAAGAR 250 P RK ++ S ++S RSR RS G + R+R +G+R Sbjct: 1043 PATKRKRRIASDEEDSDGSQRRSRSRSRSGSGSRSRSRSGSGSR 1086 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 22.6 bits (46), Expect(2) = 2.3 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +1 Query: 556 NPGSGYGATPALHSSKDSRXKSNPPEQKFMETT 654 N G G G S++ +S PP+Q M T Sbjct: 528 NGGGGGGGGGGREGSQEWNSRSRPPQQHSMLRT 560 Score = 20.6 bits (41), Expect(2) = 2.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 631 EQKFMETTLTSVSSPLSAPKKL 696 ++K L S +SPL +P K+ Sbjct: 582 QEKDRPNALASPASPLKSPSKI 603 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 23.4 bits (48), Expect = 8.0 Identities = 9/22 (40%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 668 VPPFRPP----KSYSGTTWFVR 721 +PPFRPP + G W++R Sbjct: 89 IPPFRPPWHPRPPFGGRPWWLR 110 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 833,634 Number of Sequences: 2352 Number of extensions: 18730 Number of successful extensions: 108 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 107 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -