BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0865 (642 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9YVM2 Cluster: Putative uncharacterized protein MSV220... 35 1.5 UniRef50_Q5CGA9 Cluster: Putative uncharacterized protein; n=2; ... 33 5.9 UniRef50_Q4T9M9 Cluster: Chromosome undetermined SCAF7533, whole... 33 7.7 >UniRef50_Q9YVM2 Cluster: Putative uncharacterized protein MSV220; n=1; Melanoplus sanguinipes entomopoxvirus|Rep: Putative uncharacterized protein MSV220 - Melanoplus sanguinipes entomopoxvirus (MsEPV) Length = 120 Score = 35.1 bits (77), Expect = 1.5 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +2 Query: 32 HSNLHHLF--IFKYKNYDFIKLHCSHRVKKYIIHHSETLD 145 +SN LF I+KY+NY+ + H S +K YI+H+ D Sbjct: 56 NSNYKELFKKIYKYRNYEHLINHYSEIIKNYILHNYSLFD 95 >UniRef50_Q5CGA9 Cluster: Putative uncharacterized protein; n=2; Cryptosporidium|Rep: Putative uncharacterized protein - Cryptosporidium hominis Length = 378 Score = 33.1 bits (72), Expect = 5.9 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +2 Query: 5 QKSSLTSISHSNLHHLFIFKYKNYDFIKLHCSHRVKKYI 121 Q S +T +SN + ++ KYKNY+ I +H Y+ Sbjct: 31 QNSGITPREYSNYYRFYVNKYKNYNSINIHSVQSNNDYL 69 >UniRef50_Q4T9M9 Cluster: Chromosome undetermined SCAF7533, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome undetermined SCAF7533, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 646 Score = 32.7 bits (71), Expect = 7.7 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +2 Query: 50 LFIFKYKNYDFIKLHCSHRVKKYIIHHSETL-DIRGISNNA 169 L +FKYK D +K+H S + +Y+ ++T+ D R +SN A Sbjct: 547 LALFKYKEDDILKIHSSVELYQYLRFFTKTITDTRRLSNMA 587 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,572,221 Number of Sequences: 1657284 Number of extensions: 9824999 Number of successful extensions: 21965 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21964 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48126133708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -