BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0865 (642 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosa... 26 5.3 SPAC15A10.04c |zpr1||zinc finger protein Zpr1|Schizosaccharomyce... 25 7.0 SPCC1322.08 |srk1|mkp1|MAPK-activated protein kinase Srk1|Schizo... 25 9.3 >SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosaccharomyces pombe|chr 1|||Manual Length = 1162 Score = 25.8 bits (54), Expect = 5.3 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 2 LQKSSLTSISHSNLHHLFIFKYKNYDFIKLHCS 100 L S ++S S N+H L+ F K+ + KLH S Sbjct: 333 LDFSDISSPSVMNIHPLYSFSSKSLESSKLHYS 365 >SPAC15A10.04c |zpr1||zinc finger protein Zpr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 459 Score = 25.4 bits (53), Expect = 7.0 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -1 Query: 513 MYSSYIECPQCLHYCTSHLVL 451 +++ + CP C H C +H+ L Sbjct: 252 VHTFHATCPSCSHQCDTHMKL 272 >SPCC1322.08 |srk1|mkp1|MAPK-activated protein kinase Srk1|Schizosaccharomyces pombe|chr 3|||Manual Length = 580 Score = 25.0 bits (52), Expect = 9.3 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 Query: 218 HAVDDCSNVGYTCPRDVRFTRTTQG 292 H C +GYT P VR R ++G Sbjct: 319 HTQTPCGTMGYTAPEIVRDERYSKG 343 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,340,795 Number of Sequences: 5004 Number of extensions: 42311 Number of successful extensions: 103 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -