BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0863 (685 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 22 5.4 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 7.1 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 9.4 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.8 bits (44), Expect = 5.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 590 SHETRRPFSKKTLVQENSNGAR 655 +H +PF+ K V SNG R Sbjct: 475 THLQHQPFTYKITVNNQSNGNR 496 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = -3 Query: 62 HCYNITRNYIDLYYRLFVY 6 H +NYI +Y+L +Y Sbjct: 150 HTVEYFQNYIHFFYQLLLY 168 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/42 (21%), Positives = 18/42 (42%) Frame = +1 Query: 433 YTVKSIRRLYGCSAITAVELIRLVPYNQRYRRAVAWKPPSSS 558 + K I +LYG + + + + Y A+ W S++ Sbjct: 223 FMCKKINKLYGHQLLLTILTYLIWTIYEMYHLAILWSCTSTN 264 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,293 Number of Sequences: 336 Number of extensions: 3593 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -