BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0863 (685 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC513.07 |||flavonol reductase/cinnamoyl-CoA reductase family|... 27 1.9 SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3 ... 26 5.8 >SPAC513.07 |||flavonol reductase/cinnamoyl-CoA reductase family|Schizosaccharomyces pombe|chr 1|||Manual Length = 336 Score = 27.5 bits (58), Expect = 1.9 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +1 Query: 439 VKSIRRLYGCSAITAVELIRLVPYNQRYRRAVAWKPPSSSHAFARXRNSIIA 594 VKSI+R+ S+ AV ++ P+N + W P + A N I+A Sbjct: 115 VKSIKRIVITSSFAAVGNFQIDPHNNKVYTEKDWNPITYEEALTTD-NGIVA 165 >SPAC24B11.10c |chr3|cfh1|chitin synthase regulatory factor Chr3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 932 Score = 25.8 bits (54), Expect = 5.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 590 SHETRRPFSKKTLVQENSNGARSLAT 667 SH +RR + K+ LV +NG R+ T Sbjct: 4 SHSSRRKYEKEKLVFATNNGKRTEGT 29 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,793,936 Number of Sequences: 5004 Number of extensions: 57195 Number of successful extensions: 101 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 315915086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -