BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0863 (685 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38662| Best HMM Match : HC2 (HMM E-Value=0.75) 31 0.87 SB_46977| Best HMM Match : Cu_amine_oxid (HMM E-Value=3.9e-09) 29 4.6 SB_21044| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 6.1 >SB_38662| Best HMM Match : HC2 (HMM E-Value=0.75) Length = 280 Score = 31.1 bits (67), Expect = 0.87 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +2 Query: 557 RTRSQXNATVSSHETRRPFSKKTLVQENSNGAR 655 RT S + +VSSH T RP S+KT V++ S+ R Sbjct: 59 RTSSSRSTSVSSHRT-RPSSRKTSVRKTSSSRR 90 >SB_46977| Best HMM Match : Cu_amine_oxid (HMM E-Value=3.9e-09) Length = 549 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +1 Query: 43 RVIL*QCVKYVQG*SKPTERAALVPVWKAIR--RLQLIARS 159 RV L C+ +V+ P A P W AIR L+L+ RS Sbjct: 392 RVYLAWCILFVETRGNPKSLKAFQPFWPAIRLSELELVRRS 432 >SB_21044| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1507 Score = 28.3 bits (60), Expect = 6.1 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = -3 Query: 596 RAMILLRXLANACELDGGFXATARRYRWLYGTSLISSTAVIAEQPYNRRID 444 R ++ +R +A C L G F T+ W +G +L + AE PY D Sbjct: 406 RVILPIRWMAPECILQGKF--TSASDVWAFGVTLWEILTLAAEYPYGDLTD 454 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,465,310 Number of Sequences: 59808 Number of extensions: 438928 Number of successful extensions: 1260 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1258 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -