BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0863 (685 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g25500.2 68414.m03166 choline transporter-related contains we... 29 2.2 At1g25500.1 68414.m03167 choline transporter-related contains we... 29 2.2 >At1g25500.2 68414.m03166 choline transporter-related contains weak similarity to CD92 protein [Homo sapiens] gi|16945323|emb|CAC82175 Length = 488 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +3 Query: 252 MVLKRSPLYTGALLCATI*CIL*GT--HLLITTAKEEFSHSSRSQLMALLR 398 +VL S +TGA+LC T+ I+ G H+L +EE S S L+ LR Sbjct: 236 VVLSVSLFWTGAVLCNTVHVIVSGMVFHVLFHCGQEESSSLPPSSLVDSLR 286 >At1g25500.1 68414.m03167 choline transporter-related contains weak similarity to CD92 protein [Homo sapiens] gi|16945323|emb|CAC82175 Length = 432 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +3 Query: 252 MVLKRSPLYTGALLCATI*CIL*GT--HLLITTAKEEFSHSSRSQLMALLR 398 +VL S +TGA+LC T+ I+ G H+L +EE S S L+ LR Sbjct: 236 VVLSVSLFWTGAVLCNTVHVIVSGMVFHVLFHCGQEESSSLPPSSLVDSLR 286 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,424,938 Number of Sequences: 28952 Number of extensions: 294212 Number of successful extensions: 668 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 668 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1447936096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -