BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0861 (745 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37399| Best HMM Match : Transposase_11 (HMM E-Value=0.0017) 29 3.0 SB_47786| Best HMM Match : Ank (HMM E-Value=4.4e-30) 29 4.0 >SB_37399| Best HMM Match : Transposase_11 (HMM E-Value=0.0017) Length = 340 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -1 Query: 697 IYHRMVERSITGYHGTRN*YRTEPALILGTNHHTRYAYISFLFNIH 560 IY + E I Y G R+ + LI+ H RY + F+ ++H Sbjct: 186 IYRPLTEPQILFYSGHRHYHCFNTLLIIDNQGHLRYVHAGFMGSMH 231 >SB_47786| Best HMM Match : Ank (HMM E-Value=4.4e-30) Length = 796 Score = 29.1 bits (62), Expect = 4.0 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 619 LVLVPSGINSWSHGIRLWIAPPSGGKW-GSPISIPRMVQSKV 741 L L+P + + HG L I PS W G I++ RM+++ + Sbjct: 287 LPLIPQALPRYLHGHTLVIEAPSKSSWHGVHINVKRMIRNSL 328 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,156,540 Number of Sequences: 59808 Number of extensions: 420605 Number of successful extensions: 689 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2010148439 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -