BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0859 (596 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 6.0 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 21 7.9 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.4 bits (43), Expect = 6.0 Identities = 5/15 (33%), Positives = 10/15 (66%) Frame = +3 Query: 378 YWVLEMPGGDGWELG 422 +W++ P G +E+G Sbjct: 313 FWIIVAPAGSNFEIG 327 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.0 bits (42), Expect = 7.9 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +3 Query: 282 REFINTVKKGDVLITGRGVGGLIGHAAIMTSDYWV 386 + FI + D+ ITG+ + + DY+V Sbjct: 365 QRFIQQIGNSDIAITGKNFFSITRGLILSFVDYFV 399 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,980 Number of Sequences: 336 Number of extensions: 2131 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -