BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0859 (596 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC088356-1|AAH88356.1| 518|Homo sapiens malate dehydrogenase 1B... 33 1.0 BC033509-1|AAH33509.1| 283|Homo sapiens MDH1B protein protein. 33 1.0 AC008269-1|AAX93274.1| 283|Homo sapiens unknown protein. 33 1.0 >BC088356-1|AAH88356.1| 518|Homo sapiens malate dehydrogenase 1B, NAD (soluble) protein. Length = 518 Score = 32.7 bits (71), Expect = 1.0 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +3 Query: 279 KREFINTVKKGDVLITGRGVGGLIG-HAAIMTSDYWVLEMPGGDGWELGI 425 KREF+ +K ++ TGR GG++ H+ T YW P G+ LGI Sbjct: 355 KREFVAILK--NLTTTGRQFGGILAAHSIATTLKYWYHGSPPGEIVSLGI 402 >BC033509-1|AAH33509.1| 283|Homo sapiens MDH1B protein protein. Length = 283 Score = 32.7 bits (71), Expect = 1.0 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +3 Query: 279 KREFINTVKKGDVLITGRGVGGLIG-HAAIMTSDYWVLEMPGGDGWELGI 425 KREF+ +K ++ TGR GG++ H+ T YW P G+ LGI Sbjct: 142 KREFVAILK--NLTTTGRQFGGILAAHSIATTLKYWYHGSPPGEIVSLGI 189 >AC008269-1|AAX93274.1| 283|Homo sapiens unknown protein. Length = 283 Score = 32.7 bits (71), Expect = 1.0 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +3 Query: 279 KREFINTVKKGDVLITGRGVGGLIG-HAAIMTSDYWVLEMPGGDGWELGI 425 KREF+ +K ++ TGR GG++ H+ T YW P G+ LGI Sbjct: 142 KREFVAILK--NLTTTGRQFGGILAAHSIATTLKYWYHGSPPGEIVSLGI 189 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,169,618 Number of Sequences: 237096 Number of extensions: 1349596 Number of successful extensions: 2803 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2803 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6324506272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -