BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0854 (545 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 6.2 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 8.2 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 45 SRVSLEDGGVLSCRA 1 S V +EDGG SC A Sbjct: 487 SHVMVEDGGEYSCMA 501 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 45 SRVSLEDGGVLSCRA 1 S V +EDGG SC A Sbjct: 487 SHVMVEDGGEYSCMA 501 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 168 EYFMLLCQLTRDRDRSKHESL 230 E FM+LC L R +R + L Sbjct: 449 EKFMILCNLMRTMNRKQISEL 469 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/37 (24%), Positives = 18/37 (48%) Frame = +1 Query: 304 MGVVGYLVPADAVQ*CFVIRIIVYLCKDYEQNVHNEL 414 + ++ +VP + VQ CF Y+ K+ +E+ Sbjct: 188 LDIIRNMVPENLVQACFQQAQTTYVTKEVATGTASEI 224 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,282 Number of Sequences: 438 Number of extensions: 3079 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -