BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0853 (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 23 3.0 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 5.3 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 7.0 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 7.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 7.0 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 9.2 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.0 bits (47), Expect = 3.0 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +1 Query: 493 VGQ*PSGQGEKKREDPMVELFPDDDHDDNRNNKSDVADAADALRPA 630 VG+ +G G V +DD DD ++ D +AA+ +PA Sbjct: 369 VGRNGAGVGAMNANGEAVGEVDEDDDDDGDDDDDDDVEAANG-KPA 413 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 668 QAPQPGSYSTRSQGP 712 QAPQ GS SQGP Sbjct: 32 QAPQRGSPPNPSQGP 46 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 378 AAQQHLQASEQRV 416 A QQHLQA EQ + Sbjct: 190 AQQQHLQAHEQHM 202 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 550 LFPDDDHDDNRNNKSDVADAADALRPASE 636 L P+ + NN+ + +D RPAS+ Sbjct: 862 LIPEQTSISHENNQPTMNKCSDRKRPASQ 890 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 7.0 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +2 Query: 236 LSILDWGSSGNDGSGISPSVRRGREAKTPHAGSQAVPRER 355 LSI GS D + S + R + H G Q R+R Sbjct: 1401 LSISRAGSRDEDSTRDSTKLDRSSREREVHNGGQQEDRDR 1440 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 483 ISLSYLRMEAMNSKC 439 IS+SY E +N+KC Sbjct: 341 ISVSYPSTETLNTKC 355 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,657 Number of Sequences: 438 Number of extensions: 3508 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -