BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0853 (740 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 31 0.61 At5g43040.1 68418.m05254 DC1 domain-containing protein contains ... 31 1.1 At4g30980.1 68417.m04397 basic helix-loop-helix (bHLH) family pr... 31 1.1 At3g05130.1 68416.m00557 expressed protein ; expression supporte... 31 1.1 At5g43030.1 68418.m05250 DC1 domain-containing protein contains ... 30 1.4 At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family pr... 30 1.9 At2g24260.1 68415.m02898 basic helix-loop-helix (bHLH) family pr... 30 1.9 At3g61340.1 68416.m06864 F-box family protein contains F-box dom... 29 2.4 At1g03040.1 68414.m00276 basic helix-loop-helix (bHLH) family pr... 29 2.4 At1g54440.1 68414.m06210 3'-5' exonuclease domain-containing pro... 29 3.2 At4g10760.1 68417.m01756 methyltransferase MT-A70, putative simi... 29 4.3 At3g24255.1 68416.m03045 expressed protein 29 4.3 At3g23910.1 68416.m03004 expressed protein 29 4.3 At2g36300.1 68415.m04455 integral membrane Yip1 family protein c... 29 4.3 At4g31800.1 68417.m04517 WRKY family transcription factor 28 5.7 At3g60530.1 68416.m06770 zinc finger (GATA type) family protein ... 28 5.7 At1g68870.1 68414.m07879 hypothetical protein 28 5.7 At4g21560.3 68417.m03116 vacuolar protein sorting-associated pro... 28 7.5 At4g21560.2 68417.m03115 vacuolar protein sorting-associated pro... 28 7.5 At4g21560.1 68417.m03114 vacuolar protein sorting-associated pro... 28 7.5 At2g25660.1 68415.m03075 expressed protein 28 7.5 At1g09720.1 68414.m01091 kinase interacting family protein simil... 28 7.5 At5g58010.1 68418.m07258 basic helix-loop-helix (bHLH) family pr... 27 9.9 At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family... 27 9.9 At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family... 27 9.9 At4g14150.1 68417.m02183 phragmoplast-associated kinesin-related... 27 9.9 At3g13000.2 68416.m01620 expressed protein contains Pfam profile... 27 9.9 At3g02990.1 68416.m00294 heat shock factor protein 2 (HSF2) / he... 27 9.9 At2g30500.1 68415.m03715 kinase interacting family protein simil... 27 9.9 At1g06420.1 68414.m00679 expressed protein ; expression supporte... 27 9.9 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 31.5 bits (68), Expect = 0.61 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -1 Query: 524 FSP*PDGYCP--TLRLYRCRIYVWKP*TPNAYSPPPAVY 414 +SP P Y P + +Y+ YV+ P AYSPPP+ Y Sbjct: 152 YSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 190 Score = 31.5 bits (68), Expect = 0.61 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -1 Query: 524 FSP*PDGYCP--TLRLYRCRIYVWKP*TPNAYSPPPAVY 414 +SP P Y P + +Y+ YV+ P AYSPPP+ Y Sbjct: 207 YSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 245 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -1 Query: 527 FFSP*PDGYCP--TLRLYRCRIYVWKP*TPNAYSPPPAVY 414 + SP P Y P + +Y+ YV+ P AYSPPP+ Y Sbjct: 64 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 103 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -1 Query: 527 FFSP*PDGYCP--TLRLYRCRIYVWKP*TPNAYSPPPAVY 414 + SP P Y P + +Y+ YV+ P AYSPPP+ Y Sbjct: 88 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 127 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -1 Query: 527 FFSP*PDGYCP--TLRLYRCRIYVWKP*TPNAYSPPPAVYA 411 + SP P Y P + +Y+ YV+ P AYSPPP Y+ Sbjct: 175 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPYAYS 215 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -1 Query: 527 FFSP*PDGYCP--TLRLYRCRIYVWKP*TPNAYSPPPAVY 414 + SP P Y P + +Y+ YV+ P AYSPPP+ Y Sbjct: 230 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 269 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -1 Query: 527 FFSP*PDGYCP--TLRLYRCRIYVWKP*TPNAYSPPPAVY 414 + SP P Y P + +Y+ YV+ P AYSPPP+ Y Sbjct: 254 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 293 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -1 Query: 527 FFSP*PDGYCP--TLRLYRCRIYVWKP*TPNAYSPPPAVY 414 + SP P Y P + +Y+ YV+ P AYSPPP+ Y Sbjct: 278 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 317 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -1 Query: 527 FFSP*PDGYCP--TLRLYRCRIYVWKP*TPNAYSPPPAVY 414 + SP P Y P + +Y+ YV+ P AYSPPP+ Y Sbjct: 302 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 341 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -1 Query: 527 FFSP*PDGYCP--TLRLYRCRIYVWKP*TPNAYSPPPAVY 414 + SP P Y P + +Y+ YV+ P AYSPPP+ Y Sbjct: 326 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 365 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -1 Query: 527 FFSP*PDGYCP--TLRLYRCRIYVWKP*TPNAYSPPPAVY 414 + SP P Y P + +Y+ YV+ P AYSPPP+ Y Sbjct: 40 YSSPPPYTYSPPPSPYVYKSPPYVYSSPPPYAYSPPPSPY 79 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = -1 Query: 527 FFSP*PDGYCP--TLRLYRCRIYVWKP*TPNAYSPPPAVYA 411 + SP P Y P + +Y+ YV+ P YSPPP Y+ Sbjct: 350 YSSPPPYAYSPPPSPYVYKSPPYVYSSPPPYTYSPPPYAYS 390 >At5g43040.1 68418.m05254 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 551 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = -1 Query: 317 FLLLC-LDGLKV--RCQSRHYLSFPNPRSIASMLFFTREAFSFSCSVLVARPASSCVC 153 ++ LC GL V +C + + P +L F + +FSF C A SC+C Sbjct: 94 YIYLCSFSGLPVCEKCARKPFTIDPGRAHEHPLLVFLKGSFSFPCDACGVNDAKSCLC 151 >At4g30980.1 68417.m04397 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 310 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +2 Query: 287 PSVRRGR-EAKTPHAGSQAVPRERLAEGRAGCSSATPAGFRTTRTQLEEE 433 P VR R +A PH+ ++ + RER+AE P G +T + + +E Sbjct: 128 PKVRARRGQATDPHSIAERLRRERIAERMKSLQELVPNGNKTDKASMLDE 177 >At3g05130.1 68416.m00557 expressed protein ; expression supported by MPSS Length = 634 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 282 SHLQSVEAEKQKLRTQVRRLCQENAWLRDEL 374 + + S+ K +L T++ R CQE LRDEL Sbjct: 71 NQIDSLVQAKDELETELARYCQEKTGLRDEL 101 >At5g43030.1 68418.m05250 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 564 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Frame = -1 Query: 317 FLLLC-LDGLKV--RCQSRHYLSFPNPRSIASMLFFTREAFSFSCSVLVARPASSCVC 153 ++ C GL V +C + ++ P +L F + +FSF C A+SC+C Sbjct: 89 YMYYCSFSGLPVCKQCVRKPFILDPEKAHEHPLLIFLKGSFSFPCDACGVNDANSCLC 146 >At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family protein similar to A. thaliana putative protein F6I18.110, GenBank accession number 2980768 Length = 310 Score = 29.9 bits (64), Expect = 1.9 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +2 Query: 257 SSGNDGSGISPSVRRGR-EAKTPHAGSQAVPRERLAEGRAGCSSATPAGFRTTRTQLEEE 433 S+ + + I P VR R +A PH+ ++ + RER+AE P +T R + +E Sbjct: 134 SAPHQPTSIRPRVRARRGQATDPHSIAERLRRERIAERIRALQELVPTVNKTDRAAMIDE 193 >At2g24260.1 68415.m02898 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 350 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +2 Query: 296 RRGREAKTPHAGSQAVPRERLAEGRAGCSSATPAGFRTTRTQLEEE 433 RRG +A PH+ ++ + RER+AE P G +T + + +E Sbjct: 141 RRG-QATDPHSIAERLRRERIAERMKALQELVPNGNKTDKASMLDE 185 >At3g61340.1 68416.m06864 F-box family protein contains F-box domain Pfam:PF00646 Length = 410 Score = 29.5 bits (63), Expect = 2.4 Identities = 17/73 (23%), Positives = 32/73 (43%) Frame = -1 Query: 326 RAEFLLLCLDGLKVRCQSRHYLSFPNPRSIASMLFFTREAFSFSCSVLVARPASSCVCSA 147 R + L CL C++ + S P+P+ ++ + +F SC + RP +C Sbjct: 70 RPKILFTCLKD----CET-FFFSSPHPQDLSPIAANLHMSFPISCPSNICRPVRGWLCGL 124 Query: 146 LRASSPAATVRAP 108 + ++ TV P Sbjct: 125 HQRTTKGTTVTEP 137 >At1g03040.1 68414.m00276 basic helix-loop-helix (bHLH) family protein component of the pyruvate dehydrogenase complex E3, contains PF|00010 helix-loop-helix DNA-binding domain. ESTs gb|T45640 and gb|T22783 come from this gene Length = 302 Score = 29.5 bits (63), Expect = 2.4 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 275 SGISPSVRRGR-EAKTPHAGSQAVPRERLAEGRAGCSSATPAGFRTTRTQLEEE 433 S I P VR R +A PH+ ++ + RER+AE P +T R + +E Sbjct: 138 STIRPRVRARRGQATDPHSIAERLRRERIAERIRSLQELVPTVNKTDRAAMIDE 191 >At1g54440.1 68414.m06210 3'-5' exonuclease domain-containing protein / helicase and RNase D C-terminal domain-containing protein / HRDC domain-containing protein similar to SP|Q01780 Polymyositis/scleroderma autoantigen 2 {Homo sapiens}; contains Pfam profiles PF00570: HRDC domain, PF01612: 3'-5' exonuclease Length = 738 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 523 KKREDPMVELFPDDDHDDNRNNKSDVADAADALRPASE 636 K + D ++ + DDD DD+ + AADAL SE Sbjct: 644 KSKPDKVIIVVDDDDDDDDDESYEQSTKAADALDRVSE 681 >At4g10760.1 68417.m01756 methyltransferase MT-A70, putative similar to (N6-adenosine)-methyltransferase [Mus musculus] GI:10179948, m6A methyltransferase (MT-A70) [Homo sapiens] GI:2460037; contains Pfam profile PF05063: MT-A70 (S-adenosylmethionine-binding subunit of human mRNA:m6A methyl-transferase (MTase)) Length = 685 Score = 28.7 bits (61), Expect = 4.3 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 5/63 (7%) Frame = -3 Query: 462 MEAMNSKCL-----FSSSSCVRVVRKPAGVAELQPARPSARRSLGTACEPACGVFASLPR 298 + AM ++CL FS + V+RK +PA +A R LG C P V +L Sbjct: 122 VRAMVAECLLQRVPFSPTDSSTVLRKLENDQNARPAEKAALRDLGGECGPILAVETALKS 181 Query: 297 RTE 289 E Sbjct: 182 MAE 184 >At3g24255.1 68416.m03045 expressed protein Length = 836 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 276 LASHLQSVEAEKQKLRTQVRRLCQENA 356 L + LQSVEAE K+ ++ RL Q +A Sbjct: 497 LRNELQSVEAESAKVSEEIERLSQSHA 523 >At3g23910.1 68416.m03004 expressed protein Length = 421 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 276 LASHLQSVEAEKQKLRTQVRRLCQENA 356 L + LQSVEAE K+ ++ RL Q +A Sbjct: 82 LRNELQSVEAESAKVSEEIERLSQSHA 108 >At2g36300.1 68415.m04455 integral membrane Yip1 family protein contains Pfam domain, PF04893: Yip1 domain Length = 255 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/49 (36%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = +2 Query: 260 SGNDGSGISPSVRR--GREAKTPHAGSQAVPRERLAEGRAGCSSATPAG 400 SG G + RR + P S A+P G A SSATPAG Sbjct: 14 SGGSSGGANVQQRRFPATPFQPPRPSSSAIPFMSFDIGSAAASSATPAG 62 >At4g31800.1 68417.m04517 WRKY family transcription factor Length = 310 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +3 Query: 240 RSWIGEAQVMTALASHLQSVEAEKQKLRTQVRRLCQENAWLRDELAAAQ 386 R W+ + + + L L V +E +KL + R+C+ L + L Q Sbjct: 37 RKWLEQDESASELREELNRVNSENKKLTEMLARVCESYNELHNHLEKLQ 85 >At3g60530.1 68416.m06770 zinc finger (GATA type) family protein identical to cDNA for GATA transcription factor 4 GI:2959735 Length = 240 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/67 (25%), Positives = 31/67 (46%) Frame = -1 Query: 263 LSFPNPRSIASMLFFTREAFSFSCSVLVARPASSCVCSALRASSPAATVRAPATISSCVI 84 +S P+ I +L F+ + S S + + ASS S S P++T +P ++ Sbjct: 6 MSSPDLLRIDDLLDFSNDEIFSSSSTVTSSAASSAASSENPFSFPSSTYTSPTLLTDFTH 65 Query: 83 AVILPKD 63 + +P D Sbjct: 66 DLCVPSD 72 >At1g68870.1 68414.m07879 hypothetical protein Length = 147 Score = 28.3 bits (60), Expect = 5.7 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = +1 Query: 559 DDDHDDNRNNKSDVADAADALR-PASER--RVTRFRAACASS 675 DDD DD+ NN+SD + +DA P++ + R T+ AA +S Sbjct: 62 DDDDDDSSNNESDDSMTSDASSWPSTHQPPRSTKNHAAAKNS 103 >At4g21560.3 68417.m03116 vacuolar protein sorting-associated protein 28 family protein / VPS28 family protein contains similarity to Swiss-Prot:Q02767 vacuolar protein sorting-associated protein VPS28 [Saccharomyces cerevisiae] Length = 209 Score = 27.9 bits (59), Expect = 7.5 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Frame = -1 Query: 212 EAFSFSCSVLVARPASSCVCSAL--RASSPAATVRAPATISSCVIAVILPKDSIFFLSK* 39 E + CS V R +S V + + RA++ A+T + + ++ CV I DS+ Sbjct: 75 ETYKMDCSAAVYRLVTSGVPATVEHRAAASASTSSSASVVAECVQNFITSMDSLKLNMVA 134 Query: 38 LDRSTAILNSL 6 +D+ +L+ L Sbjct: 135 VDQVYPLLSDL 145 >At4g21560.2 68417.m03115 vacuolar protein sorting-associated protein 28 family protein / VPS28 family protein contains similarity to Swiss-Prot:Q02767 vacuolar protein sorting-associated protein VPS28 [Saccharomyces cerevisiae] Length = 209 Score = 27.9 bits (59), Expect = 7.5 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Frame = -1 Query: 212 EAFSFSCSVLVARPASSCVCSAL--RASSPAATVRAPATISSCVIAVILPKDSIFFLSK* 39 E + CS V R +S V + + RA++ A+T + + ++ CV I DS+ Sbjct: 75 ETYKMDCSAAVYRLVTSGVPATVEHRAAASASTSSSASVVAECVQNFITSMDSLKLNMVA 134 Query: 38 LDRSTAILNSL 6 +D+ +L+ L Sbjct: 135 VDQVYPLLSDL 145 >At4g21560.1 68417.m03114 vacuolar protein sorting-associated protein 28 family protein / VPS28 family protein contains similarity to Swiss-Prot:Q02767 vacuolar protein sorting-associated protein VPS28 [Saccharomyces cerevisiae] Length = 209 Score = 27.9 bits (59), Expect = 7.5 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Frame = -1 Query: 212 EAFSFSCSVLVARPASSCVCSAL--RASSPAATVRAPATISSCVIAVILPKDSIFFLSK* 39 E + CS V R +S V + + RA++ A+T + + ++ CV I DS+ Sbjct: 75 ETYKMDCSAAVYRLVTSGVPATVEHRAAASASTSSSASVVAECVQNFITSMDSLKLNMVA 134 Query: 38 LDRSTAILNSL 6 +D+ +L+ L Sbjct: 135 VDQVYPLLSDL 145 >At2g25660.1 68415.m03075 expressed protein Length = 2146 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +3 Query: 243 SWIGEAQVMTALASHLQSVEAEKQKLRTQVRRLCQENAWLR 365 +W+G T L SHL S E RT+ RR+ +E A +R Sbjct: 222 TWLGIPLSDTTLPSHLSSEEG--IDFRTKTRRVSREEAGIR 260 >At1g09720.1 68414.m01091 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 928 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +3 Query: 270 TALASHLQSVEAEKQKLRTQVRRLCQENAWLRDEL 374 TALAS + + +++RT+++ + +A LRDEL Sbjct: 734 TALASEAKPIYRHLREIRTELQLWLENSAILRDEL 768 >At5g58010.1 68418.m07258 basic helix-loop-helix (bHLH) family protein bHLH transcription factor GBOF-1, Tulipa gesneriana, EMBL:AF185269; contains Pfam profile PF00010: Helix-loop-helix DNA-binding domain Length = 297 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = +2 Query: 287 PSVRRGR-EAKTPHAGSQAVPRERLAEGRAGCSSATPAGFRTTR-TQLEEENKHLEFM 454 P VR R +A PH+ ++ + RER+AE P +T + + L+E +++ F+ Sbjct: 97 PRVRARRGQATDPHSIAERLRRERIAERMKSLQELVPNTNKTDKASMLDEIIEYVRFL 154 >At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family protein Length = 438 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +2 Query: 593 PMSPTPPMHFAQQVNAGLRDSGPPAQAPQPGSYSTRSQGP 712 P P PP +A + G R PP Q Q + QGP Sbjct: 320 PSGPPPPSGYANAMYEGGRMQYPPPQPQQQQQQAHYLQGP 359 >At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family protein Length = 496 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +2 Query: 593 PMSPTPPMHFAQQVNAGLRDSGPPAQAPQPGSYSTRSQGP 712 P P PP +A + G R PP Q Q + QGP Sbjct: 378 PSGPPPPSGYANAMYEGGRMQYPPPQPQQQQQQAHYLQGP 417 >At4g14150.1 68417.m02183 phragmoplast-associated kinesin-related protein (PAKRP1) Length = 1292 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/50 (30%), Positives = 30/50 (60%) Frame = +3 Query: 255 EAQVMTALASHLQSVEAEKQKLRTQVRRLCQENAWLRDELAAAQQHLQAS 404 E++ + ALA+ + +++ EK+K R +R EN L+ +L + +QA+ Sbjct: 1133 ESRFINALAAEISALKVEKEKERQYLR---DENKSLQTQLRDTAEAIQAA 1179 >At3g13000.2 68416.m01620 expressed protein contains Pfam profile PF04784: Protein of unknown function, DUF547 Length = 582 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = +2 Query: 323 HAGSQAVPRERLAEGRAGCSSATPAGFRTTRTQLEEENKHLE 448 H+G + ++EGR C +T R QLEE+ K L+ Sbjct: 19 HSGKKFQGTVTMSEGRETCEESTSGESFPYRFQLEEDVKRLQ 60 >At3g02990.1 68416.m00294 heat shock factor protein 2 (HSF2) / heat shock transcription factor 2 (HSTF2) identical to heat shock transcription factor 2 (HSF2) SP:Q96320 from [Arabidopsis thaliana]; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 468 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +3 Query: 297 VEAEKQKLRTQVRRLCQENAWLRDELAAAQQHLQASEQRVH 419 +E E ++L+ L QE LR + + HLQ Q+VH Sbjct: 142 LEEEVERLQRDKNVLMQELVRLRQQQQVTEHHLQNVGQKVH 182 >At2g30500.1 68415.m03715 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 517 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/59 (23%), Positives = 33/59 (55%) Frame = +3 Query: 240 RSWIGEAQVMTALASHLQSVEAEKQKLRTQVRRLCQENAWLRDELAAAQQHLQASEQRV 416 RS +GE + L SH++ ++ EK + ++R ++ + +RDE ++ + E+++ Sbjct: 381 RSQLGEQ--LRELESHIRLIKEEKAETEEKLRGGTEKISGMRDESNVLREEIGKREEKI 437 >At1g06420.1 68414.m00679 expressed protein ; expression supported by MPSS Length = 221 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +3 Query: 297 VEAEKQKLRTQVRRLCQENAWLRDELAAAQQHLQAS 404 V+ E+ L VR C N W RD++ ++ ++ S Sbjct: 77 VKLEEHSLSGGVRMHCSVNRWKRDQVCVKKEEIKVS 112 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,949,623 Number of Sequences: 28952 Number of extensions: 276292 Number of successful extensions: 1400 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 1172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1347 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1633819784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -