BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0852 (593 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 22 4.5 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 22 4.5 DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like pr... 22 4.5 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 21 5.9 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.8 bits (44), Expect = 4.5 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 199 SNVNPNA-GVKDMQVLQSTXM*SPRLLTVYQRRWLPLKNIFTSLSPLE 339 S +NP GV +++ ++ SPR+ T+ +P N + L PLE Sbjct: 324 SCMNPVVYGVFNIRARRTGRKVSPRVNTIKHTSCIPTPNGDSRLPPLE 371 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.8 bits (44), Expect = 4.5 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 199 SNVNPNA-GVKDMQVLQSTXM*SPRLLTVYQRRWLPLKNIFTSLSPLE 339 S +NP GV +++ ++ SPR+ T+ +P N + L PLE Sbjct: 324 SCMNPVVYGVFNIRARRTGRKVSPRVNTIKHTSCIPTPNGDSRLPPLE 371 >DQ138190-1|ABA03054.1| 135|Tribolium castaneum bursicon-like protein protein. Length = 135 Score = 21.8 bits (44), Expect = 4.5 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = -1 Query: 239 TCI-SLTPALGLTLEMMXSDLPCSRWEHRDRSRLRCTITVRLRVR*TLQSDKSQTRPPVL 63 TC+ S++ T E + SD+ + E + RL+ + V S KSQ +P V+ Sbjct: 13 TCVYSVSEISEETCETLMSDINLIKEEFDELGRLQRICNGEVAVNKCEGSCKSQVQPSVI 72 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.4 bits (43), Expect = 5.9 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 Query: 129 NCPPSCEVDTSVGQIPNT 76 N PPS S+GQ P T Sbjct: 62 NSPPSSTSSGSLGQFPAT 79 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,459 Number of Sequences: 336 Number of extensions: 2808 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -