BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0852 (593 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19B12.01 ||SPAC4F10.21|TPR repeat protein, TTC27 family|Schi... 28 1.2 SPAC31F12.01 |zds1|SPAC637.14, mug88|zds family protein Zds1|Sch... 27 2.1 SPBP26C9.03c |||iron ion transporter |Schizosaccharomyces pombe|... 26 4.8 SPBC32C12.03c |ppk25||serine/threonine protein kinase Ppk25 |Sch... 25 6.3 >SPAC19B12.01 ||SPAC4F10.21|TPR repeat protein, TTC27 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 817 Score = 27.9 bits (59), Expect = 1.2 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +3 Query: 24 EPSSRCCRMNKNHQHRWTCLGFVRLKCLPHTKADSYCAPQ 143 E SRC +N W L LK HTK ++ A Q Sbjct: 576 EAFSRCLSINPEDGESWNNLASAMLKAKDHTKEQAWHAMQ 615 >SPAC31F12.01 |zds1|SPAC637.14, mug88|zds family protein Zds1|Schizosaccharomyces pombe|chr 1|||Manual Length = 938 Score = 27.1 bits (57), Expect = 2.1 Identities = 8/34 (23%), Positives = 20/34 (58%) Frame = -3 Query: 135 HNNCPPSCEVDTSVGQIPNTSTCVDGFCSFCSNE 34 HN+ PP + ++ ++PNT++ + C +++ Sbjct: 758 HNDAPPKAKPISAPSELPNTTSVAEAKCQTVTDD 791 >SPBP26C9.03c |||iron ion transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 584 Score = 25.8 bits (54), Expect = 4.8 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = -2 Query: 541 CSDVIGNALGNSLTAPRQAWSFLGTFSPL*GFSKIMLLTSVHLLEGA 401 C V A+GN + W +GT++ L GF +L +V+ E + Sbjct: 402 CVFVAWIAIGNVMHWDSNWWLIIGTYTGLVGFLDGFVLRNVYFRESS 448 >SPBC32C12.03c |ppk25||serine/threonine protein kinase Ppk25 |Schizosaccharomyces pombe|chr 2|||Manual Length = 423 Score = 25.4 bits (53), Expect = 6.3 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 108 PHTKADSYCAPQPRPVPVLPSRTGQIRXHHFQ 203 P K +S+C P P+ +PS T IR H F+ Sbjct: 303 PWLKKNSFCLYLPIPLTSIPS-TPSIRSHVFK 333 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,337,527 Number of Sequences: 5004 Number of extensions: 46076 Number of successful extensions: 135 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 135 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 258201856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -