BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0851 (692 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 31 0.012 AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 28 0.083 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 28 0.083 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 1.8 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 23 3.1 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 5.5 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 5.5 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 5.5 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 5.5 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 5.5 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 5.5 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 5.5 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 5.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.6 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 30.7 bits (66), Expect = 0.012 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 Query: 607 KPTAAAIAYGLTKKGTWRTKCTY 675 +PTAAAIAYGL KKG + Y Sbjct: 3 EPTAAAIAYGLDKKGAEQNILVY 25 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 27.9 bits (59), Expect = 0.083 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 607 KPTAAAIAYGLTKK 648 +PTAAAIAYGL KK Sbjct: 3 EPTAAAIAYGLDKK 16 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 27.9 bits (59), Expect = 0.083 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 607 KPTAAAIAYGLTKK 648 +PTAAAIAYGL KK Sbjct: 3 EPTAAAIAYGLDKK 16 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.4 bits (48), Expect = 1.8 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +2 Query: 371 DXGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKT 496 D KPKI+ + ED+ E+ K K T + L KT Sbjct: 241 DKDKPKIEDVGEDEDEDTKKEDKKKKKTIKEKYTEDEELNKT 282 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.6 bits (46), Expect = 3.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 143 LPAREGGDHRQRPGQQDH 196 +P R+ DHR RP + H Sbjct: 246 IPIRQCDDHRDRPPRHFH 263 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 514 TVPAYFNDSQRQATKDAGTISGLERSXNSSMKPTAAAIAYGLT 642 + P S ATK +G S L S + KP + + L+ Sbjct: 125 STPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLS 167 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 514 TVPAYFNDSQRQATKDAGTISGLERSXNSSMKPTAAAIAYGLT 642 + P S ATK +G S L S + KP + + L+ Sbjct: 125 STPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLS 167 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 514 TVPAYFNDSQRQATKDAGTISGLERSXNSSMKPTAAAIAYGLT 642 + P S ATK +G S L S + KP + + L+ Sbjct: 125 STPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLS 167 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 514 TVPAYFNDSQRQATKDAGTISGLERSXNSSMKPTAAAIAYGLT 642 + P S ATK +G S L S + KP + + L+ Sbjct: 125 STPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLS 167 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 514 TVPAYFNDSQRQATKDAGTISGLERSXNSSMKPTAAAIAYGLT 642 + P S ATK +G S L S + KP + + L+ Sbjct: 125 STPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLS 167 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 514 TVPAYFNDSQRQATKDAGTISGLERSXNSSMKPTAAAIAYGLT 642 + P S ATK +G S L S + KP + + L+ Sbjct: 81 STPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLS 123 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 514 TVPAYFNDSQRQATKDAGTISGLERSXNSSMKPTAAAIAYGLT 642 + P S ATK +G S L S + KP + + L+ Sbjct: 125 STPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLS 167 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/43 (27%), Positives = 18/43 (41%) Frame = +1 Query: 514 TVPAYFNDSQRQATKDAGTISGLERSXNSSMKPTAAAIAYGLT 642 + P S ATK +G S L S + KP + + L+ Sbjct: 125 STPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLS 167 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 142 TPTQEYVVPRSIPT 101 TPT + VV R+IP+ Sbjct: 15 TPTDQRVVTRTIPS 28 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,143 Number of Sequences: 336 Number of extensions: 3711 Number of successful extensions: 17 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18218375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -