BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0849 (677 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 2.0 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 6.2 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 6.2 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 8.2 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 8.2 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.4 bits (48), Expect = 2.0 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -1 Query: 230 IASMAYSTWNSL-PSGLNVLTPRSYSERV 147 ++S + W L SG+ TPRS+S RV Sbjct: 610 LSSAVWFAWGVLLNSGIGEGTPRSFSARV 638 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 348 STIFFDGSWGSIKVEVILFSTAKTTPSEVQMPIAVE 241 ST++ +GS+G +EV T + T V + AV+ Sbjct: 142 STVYSEGSYGEYGIEVF---TREATERNVCIAAAVK 174 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 348 STIFFDGSWGSIKVEVILFSTAKTTPSEVQMPIAVE 241 ST++ +GS+G +EV T + T V + AV+ Sbjct: 232 STVYSEGSYGEYGIEVF---TREATERNVCIAAAVK 264 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 8.2 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 311 LMEPHDPSKKIVEVDRHIACAVFGSDGRLQ 400 +M+P P KI V IA F +GRL+ Sbjct: 29 MMKPTLPGYKIECVGDDIAWMKFDKEGRLR 58 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 213 ICHRSYQTWAPLQLAFVLRXELFW 284 I H QT+AP L +L FW Sbjct: 199 IGHHLIQTFAPSTLVVMLSWFSFW 222 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,386 Number of Sequences: 438 Number of extensions: 3631 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -