BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0847 (715 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0535 - 11292509-11294679,11294971-11295040,11295268-112953... 29 3.7 11_06_0684 - 26264540-26264661,26264926-26264989,26267168-262673... 29 4.8 11_06_0460 + 23836034-23836083,23836175-23836318,23836397-238364... 29 4.8 11_06_0232 + 21559467-21559532,21559586-21560200 29 4.8 05_01_0089 + 589457-589506,589598-589741,589820-589903,590118-59... 29 4.8 02_04_0420 - 22752131-22752553 28 6.4 >02_02_0535 - 11292509-11294679,11294971-11295040,11295268-11295324, 11298629-11298789,11299123-11299156 Length = 830 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 522 QRNQYLTLSVKTTPTQNHMAYGVNS 596 QR Q L+ S +T P NH ++G N+ Sbjct: 790 QRKQLLSFSQRTVPVNNHSSHGSNN 814 >11_06_0684 - 26264540-26264661,26264926-26264989,26267168-26267371, 26268322-26268456,26269174-26269492,26269581-26269631, 26269721-26269864,26270080-26270160,26270252-26270302, 26270392-26270535,26270750-26270833,26270912-26271055, 26271147-26271196 Length = 530 Score = 28.7 bits (61), Expect = 4.8 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = +3 Query: 84 PTEPQSPTPNSKTIFTTASSLPITTMPLKKANRSTRTRRAKSSQMS*TNSYETTR*THGV 263 PT+ SPT +S + A+S ++ + K R RR+ S T +Y + T+ + Sbjct: 7 PTDDGSPTQDSSNLTARANSKELSRLARSKRKRKLDLRRSGSPS---TKNYSSADETNAL 63 Query: 264 -RLPALDARLQGYR 302 R LD + G++ Sbjct: 64 QRKRKLDEKRTGFQ 77 >11_06_0460 + 23836034-23836083,23836175-23836318,23836397-23836480, 23836695-23836838,23836928-23836978,23837070-23837150, 23837366-23837509,23837599-23837649,23837738-23838056, 23839994-23840062,23840378-23840698,23841218-23841583, 23842241-23842304,23842569-23842690 Length = 669 Score = 28.7 bits (61), Expect = 4.8 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = +3 Query: 84 PTEPQSPTPNSKTIFTTASSLPITTMPLKKANRSTRTRRAKSSQMS*TNSYETTR*THGV 263 PT+ SPT +S + A+S ++ + K R RR+ S T +Y + T+ + Sbjct: 7 PTDDGSPTQDSSNLTARANSKELSRLARSKRKRKLDLRRSGSPS---TKNYSSADETNAL 63 Query: 264 -RLPALDARLQGYR 302 R LD + G++ Sbjct: 64 QRKRKLDEKRTGFQ 77 >11_06_0232 + 21559467-21559532,21559586-21560200 Length = 226 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +3 Query: 99 SPTPNSKTIFTTASSLPITTMPLKKANRSTRTRRAKSSQMS*TNSYET 242 +P P ++T ASS P T P + +R R RRA+++Q +S T Sbjct: 141 TPRPRARTRGAPASSFPGATTPQRTPDR--RGRRARAAQQGEASSRAT 186 >05_01_0089 + 589457-589506,589598-589741,589820-589903,590118-590261, 590351-590401,590492-590641,591175-591488,592685-592815, 593131-593451,594994-595057,595322-595443 Length = 524 Score = 28.7 bits (61), Expect = 4.8 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = +3 Query: 84 PTEPQSPTPNSKTIFTTASSLPITTMPLKKANRSTRTRRAKSSQMS*TNSYETTR*THGV 263 PT+ SPT +S + A+S ++ + K R RR+ S T +Y + T+ + Sbjct: 7 PTDDGSPTQDSSNLTARANSKELSRLARSKRKRKLDLRRSGSPS---TKNYSSADETNAL 63 Query: 264 -RLPALDARLQGYR 302 R LD + G++ Sbjct: 64 QRKRKLDEKRTGFQ 77 >02_04_0420 - 22752131-22752553 Length = 140 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 5/37 (13%) Frame = -2 Query: 567 GSGLF*LTTSNT-----DYAECSQSEVDLVVLPQRNE 472 G G F L +NT DYAEC Q ++ LV P NE Sbjct: 76 GKGWFGLWENNTELQAHDYAECFQEQMALVYDPAANE 112 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,640,424 Number of Sequences: 37544 Number of extensions: 307698 Number of successful extensions: 1020 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 985 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1020 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -