BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0845 (523 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21262| Best HMM Match : IL1_propep (HMM E-Value=9.4) 30 1.0 SB_46401| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 >SB_21262| Best HMM Match : IL1_propep (HMM E-Value=9.4) Length = 306 Score = 30.3 bits (65), Expect = 1.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 481 LEXTLVLIQRRYCDVNVFXLRITLMFLDYVARRHW 377 ++ L L +RRYCD +F L+ T + Y + +W Sbjct: 204 VQGQLALSKRRYCDFFIFTLKNTFVKRIYFEKNYW 238 >SB_46401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 484 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -1 Query: 502 CKALQKILEXTLVLIQRRYCDVNVFXLRITLMFLDYVAR 386 CK +K+ E + + RR+ D ++ ++ FLD AR Sbjct: 331 CKPWEKLTEEEQLSVYRRHMDNGIYEYKVFGSFLDINAR 369 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,369,111 Number of Sequences: 59808 Number of extensions: 196143 Number of successful extensions: 312 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 312 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -