BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0845 (523 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like pepti... 23 8.2 AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like pepti... 23 8.2 AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like pepti... 23 8.2 >AY324315-1|AAQ89700.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 22.6 bits (46), Expect = 8.2 Identities = 12/53 (22%), Positives = 25/53 (47%) Frame = -3 Query: 215 ILLLKYTSCLCIIRGSLELN*KSACFNYLTSLSMKKIHFYTLYISFTCMYVCN 57 +L++ + L ++ L ++ Y+ S S +K H+ +S T +CN Sbjct: 10 LLVVSCGAALLLLLVLLSVSGVDGSLQYVESNSQRKAHYCGAKLSDTLAKLCN 62 >AY324314-1|AAQ89699.1| 153|Anopheles gambiae insulin-like peptide 7 precursor protein. Length = 153 Score = 22.6 bits (46), Expect = 8.2 Identities = 12/53 (22%), Positives = 25/53 (47%) Frame = -3 Query: 215 ILLLKYTSCLCIIRGSLELN*KSACFNYLTSLSMKKIHFYTLYISFTCMYVCN 57 +L++ + L ++ L ++ Y+ S S +K H+ +S T +CN Sbjct: 10 LLVVSCGAALLLLLVLLSVSGVDGSLQYVESNSQRKAHYCGAKLSDTLAKLCN 62 >AY324307-1|AAQ89692.1| 154|Anopheles gambiae insulin-like peptide 1 precursor protein. Length = 154 Score = 22.6 bits (46), Expect = 8.2 Identities = 12/53 (22%), Positives = 25/53 (47%) Frame = -3 Query: 215 ILLLKYTSCLCIIRGSLELN*KSACFNYLTSLSMKKIHFYTLYISFTCMYVCN 57 +L++ + L ++ L ++ Y+ S S +K H+ +S T +CN Sbjct: 10 LLVVSCGTALLLLLVLLSVSGVDGSLQYVESNSQRKAHYCGAKLSDTLAKLCN 62 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 430,995 Number of Sequences: 2352 Number of extensions: 7695 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -