BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0844 (658 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48591| Best HMM Match : Galactosyl_T (HMM E-Value=2.1e-33) 31 0.62 SB_42659| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 >SB_48591| Best HMM Match : Galactosyl_T (HMM E-Value=2.1e-33) Length = 336 Score = 31.5 bits (68), Expect = 0.62 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = -3 Query: 494 FGTLRRQL**FLIKYSLFSKCVIIFVILFSSNYIVWRYVSLLMYKMYF 351 F T R+ FL+ + +CV IF++L + +++RY +YK+Y+ Sbjct: 6 FRTSYRRFLGFLLSRRV-QRCVCIFLVLLAVLILIYRYTQSSVYKIYY 52 >SB_42659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5834 Score = 30.3 bits (65), Expect = 1.4 Identities = 23/90 (25%), Positives = 37/90 (41%), Gaps = 3/90 (3%) Frame = -2 Query: 423 FCYFIFFELYCLEICFSVNVQNVFY-LECMEALIR--DKALYITXXXXXXXXXXXXKSLH 253 FCY IFF+ + C S++ + FY L C+E ++R D ++ + SL Sbjct: 4766 FCYEIFFKSALSDHCKSLHAELDFYSLVCVEDVVRAGDVSVSLVAIVTFADHCKATLSLS 4825 Query: 252 LWSQTIMTKASSGLSFLCRIKIASSKPCTF 163 W + + G F I + C F Sbjct: 4826 FWPAQKLCNSIPGALFPIWIGDSCDVRCVF 4855 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 173 GLLEAIFIRQRNDKPELALVIMVCDQRCRLLIYF 274 GL I +D PEL++ ++VC++ C L + F Sbjct: 148 GLTSGGKIMDNSDSPELSVQVVVCEKGCGLPLLF 181 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,342,730 Number of Sequences: 59808 Number of extensions: 295662 Number of successful extensions: 663 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 663 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -