BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0842 (393 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55801| Best HMM Match : EPTP (HMM E-Value=0.24) 27 7.2 SB_5380| Best HMM Match : zf-CXXC (HMM E-Value=2.9) 26 9.5 >SB_55801| Best HMM Match : EPTP (HMM E-Value=0.24) Length = 426 Score = 26.6 bits (56), Expect = 7.2 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 93 SFFFYKRVKHIALLVDYF 40 SFF YKR+ +IA +YF Sbjct: 400 SFFTYKRIHYIAFATNYF 417 >SB_5380| Best HMM Match : zf-CXXC (HMM E-Value=2.9) Length = 231 Score = 26.2 bits (55), Expect = 9.5 Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 4/35 (11%) Frame = +1 Query: 55 QCNMFDSLIKKKTFVCLPLLCN----CENGLLYVI 147 QC++ + + K T +C+ L C+ C+ LLY++ Sbjct: 28 QCSVCNEVPNKNTSICICLRCSKQNLCQTELLYLV 62 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,651,215 Number of Sequences: 59808 Number of extensions: 153302 Number of successful extensions: 216 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 216 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 678472135 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -