BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0841 (763 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 23 2.0 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 23 2.0 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 23 2.0 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.7 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.7 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 8.1 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 8.1 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 8.1 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -2 Query: 186 YNCMKFKWKRLIESIMYWNSSLG*SIVVLKWND 88 + CMK KW L S+ + N + KW + Sbjct: 153 FKCMKEKWIPLCNSVTFSNFGYKQCVENRKWQN 185 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -2 Query: 186 YNCMKFKWKRLIESIMYWNSSLG*SIVVLKWND 88 + CMK KW L S+ + N + KW + Sbjct: 386 FKCMKEKWIPLCNSVTFSNFGYKQCVENRKWQN 418 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = -2 Query: 186 YNCMKFKWKRLIESIMYWNSSLG*SIVVLKWND 88 + CMK KW L S+ + N + KW + Sbjct: 386 FKCMKEKWIPLCNSVTFSNFGYKQCVENRKWQN 418 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 91 IPFQNYDTSPQGRIPVHDGL 150 +P Y SP G IP H GL Sbjct: 217 LPSDFYRFSPTGLIPPHPGL 236 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 91 IPFQNYDTSPQGRIPVHDGL 150 +P Y SP G IP H GL Sbjct: 109 LPSDFYRFSPTGLIPPHPGL 128 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 8.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 539 KSQKVHIADFGLTTTICSFSR 601 +S + FGL T + SFSR Sbjct: 420 RSYTYQVLPFGLKTAVGSFSR 440 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +2 Query: 539 KSQKVHIADFGLTTTICSFSRW 604 K H+ D+ LTT + S W Sbjct: 267 KDPNSHLYDYDLTTHVMLLSDW 288 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +2 Query: 539 KSQKVHIADFGLTTTICSFSRW 604 K H+ D+ LTT + S W Sbjct: 267 KDPNSHLYDYDLTTHVMLLSDW 288 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,221 Number of Sequences: 336 Number of extensions: 3762 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -