BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0841 (763 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC062555-1|AAH62555.1| 523|Homo sapiens glutamic pyruvate trans... 88 4e-17 AY029173-1|AAK31794.2| 523|Homo sapiens alanine aminotransferas... 88 4e-17 AK094971-1|BAC04465.1| 423|Homo sapiens protein ( Homo sapiens ... 88 4e-17 U70732-1|AAC51155.1| 496|Homo sapiens glutamate pyruvate transa... 84 5e-16 D10355-1|BAA01186.1| 493|Homo sapiens alanine aminotransferase ... 84 5e-16 BT006992-1|AAP35638.1| 496|Homo sapiens glutamic-pyruvate trans... 84 5e-16 BC018207-1|AAH18207.1| 496|Homo sapiens GPT protein protein. 84 5e-16 >BC062555-1|AAH62555.1| 523|Homo sapiens glutamic pyruvate transaminase (alanine aminotransferase) 2 protein. Length = 523 Score = 87.8 bits (208), Expect = 4e-17 Identities = 32/61 (52%), Positives = 49/61 (80%) Frame = +2 Query: 5 PDEFYCLRLLEETGVCVIPGTGFGQLPGSFHFRTTILHPKDEFQYMMDSIRRFHLNFMQL 184 PD FYC++LLEETG+CV+PG+GFGQ G++HFR TIL P ++ + ++ ++ FH+NF++ Sbjct: 462 PDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEK 521 Query: 185 Y 187 Y Sbjct: 522 Y 522 >AY029173-1|AAK31794.2| 523|Homo sapiens alanine aminotransferase 2 protein. Length = 523 Score = 87.8 bits (208), Expect = 4e-17 Identities = 32/61 (52%), Positives = 49/61 (80%) Frame = +2 Query: 5 PDEFYCLRLLEETGVCVIPGTGFGQLPGSFHFRTTILHPKDEFQYMMDSIRRFHLNFMQL 184 PD FYC++LLEETG+CV+PG+GFGQ G++HFR TIL P ++ + ++ ++ FH+NF++ Sbjct: 462 PDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEK 521 Query: 185 Y 187 Y Sbjct: 522 Y 522 >AK094971-1|BAC04465.1| 423|Homo sapiens protein ( Homo sapiens cDNA FLJ37652 fis, clone BRHIP2009685, moderately similar to ALANINE AMINOTRANSFERASE (EC 2.6.1.2). ). Length = 423 Score = 87.8 bits (208), Expect = 4e-17 Identities = 32/61 (52%), Positives = 49/61 (80%) Frame = +2 Query: 5 PDEFYCLRLLEETGVCVIPGTGFGQLPGSFHFRTTILHPKDEFQYMMDSIRRFHLNFMQL 184 PD FYC++LLEETG+CV+PG+GFGQ G++HFR TIL P ++ + ++ ++ FH+NF++ Sbjct: 362 PDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEK 421 Query: 185 Y 187 Y Sbjct: 422 Y 422 >U70732-1|AAC51155.1| 496|Homo sapiens glutamate pyruvate transaminase protein. Length = 496 Score = 84.2 bits (199), Expect = 5e-16 Identities = 33/61 (54%), Positives = 46/61 (75%) Frame = +2 Query: 5 PDEFYCLRLLEETGVCVIPGTGFGQLPGSFHFRTTILHPKDEFQYMMDSIRRFHLNFMQL 184 PD F+CLRLLEETG+CV+PG+GFGQ G++HFR TIL P ++ + +++ + RFH F Sbjct: 435 PDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAKFTLE 494 Query: 185 Y 187 Y Sbjct: 495 Y 495 >D10355-1|BAA01186.1| 493|Homo sapiens alanine aminotransferase protein. Length = 493 Score = 84.2 bits (199), Expect = 5e-16 Identities = 33/61 (54%), Positives = 46/61 (75%) Frame = +2 Query: 5 PDEFYCLRLLEETGVCVIPGTGFGQLPGSFHFRTTILHPKDEFQYMMDSIRRFHLNFMQL 184 PD F+CLRLLEETG+CV+PG+GFGQ G++HFR TIL P ++ + +++ + RFH F Sbjct: 432 PDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAKFTLE 491 Query: 185 Y 187 Y Sbjct: 492 Y 492 >BT006992-1|AAP35638.1| 496|Homo sapiens glutamic-pyruvate transaminase (alanine aminotransferase) protein. Length = 496 Score = 84.2 bits (199), Expect = 5e-16 Identities = 33/61 (54%), Positives = 46/61 (75%) Frame = +2 Query: 5 PDEFYCLRLLEETGVCVIPGTGFGQLPGSFHFRTTILHPKDEFQYMMDSIRRFHLNFMQL 184 PD F+CLRLLEETG+CV+PG+GFGQ G++HFR TIL P ++ + +++ + RFH F Sbjct: 435 PDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAKFTLE 494 Query: 185 Y 187 Y Sbjct: 495 Y 495 >BC018207-1|AAH18207.1| 496|Homo sapiens GPT protein protein. Length = 496 Score = 84.2 bits (199), Expect = 5e-16 Identities = 33/61 (54%), Positives = 46/61 (75%) Frame = +2 Query: 5 PDEFYCLRLLEETGVCVIPGTGFGQLPGSFHFRTTILHPKDEFQYMMDSIRRFHLNFMQL 184 PD F+CLRLLEETG+CV+PG+GFGQ G++HFR TIL P ++ + +++ + RFH F Sbjct: 435 PDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAKFTLE 494 Query: 185 Y 187 Y Sbjct: 495 Y 495 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,990,908 Number of Sequences: 237096 Number of extensions: 2071912 Number of successful extensions: 3712 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3712 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9144232952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -