BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0841 (763 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 24 1.8 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 24 1.8 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 24 1.8 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 24 1.8 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 2.3 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 2.3 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.1 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 5.4 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 Query: 6 LMSSTALGCWRK 41 L+S TALGCW + Sbjct: 318 LVSDTALGCWNE 329 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 3 VLMSSTALGCWRKLECV*SRVRDSGSF 83 + +S TAL CW + E + + G+F Sbjct: 232 ISISGTALNCWTQTENSLEKAKQVGAF 258 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 3 VLMSSTALGCWRKLECV*SRVRDSGSF 83 + +S TAL CW + E + + G+F Sbjct: 103 ISISGTALNCWTQTENSLEKAKQVGAF 129 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 3 VLMSSTALGCWRKLECV*SRVRDSGSF 83 + +S TAL CW + E + + G+F Sbjct: 232 ISISGTALNCWTQTENSLEKAKQVGAF 258 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 760 LXRTSMEEQAVVPTELPXDIL 698 + R S E VVP E+P D+L Sbjct: 555 IERNSHESVFVVPDEVPSDVL 575 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 760 LXRTSMEEQAVVPTELPXDIL 698 + R S E VVP E+P D+L Sbjct: 555 IERNSHESVFVVPDEVPSDVL 575 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +2 Query: 47 VCVIPGTGFGQLPGSFHFRTTILHPKDEFQY 139 + V PGTG G +H R + + + +Y Sbjct: 969 ILVGPGTGIAPFRGFWHHRLAEIKRRPDLEY 999 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 22.2 bits (45), Expect = 5.4 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = +3 Query: 6 LMSSTALGCWRK 41 LM+++A+GCW + Sbjct: 322 LMNNSAIGCWNE 333 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,341 Number of Sequences: 438 Number of extensions: 4471 Number of successful extensions: 22 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -