BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbpv0840 (410 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 25 0.22 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 1.5 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 4.7 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 6.2 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 6.2 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 25.4 bits (53), Expect = 0.22 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 88 KFLETLGSIATKAYDLRSLLFLR 20 +FLE G +A A DLR LF R Sbjct: 379 RFLEPFGVMADPAVDLRDPLFFR 401 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 1.5 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +1 Query: 295 QAELGXSHVLRSAAGLTTKNISSFLSQRKXSQIGA 399 QAE S + A L T+N SS L + GA Sbjct: 259 QAEFTLSGQVMKYAALATENFSSLLEPAVGTMTGA 293 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 4.7 Identities = 6/25 (24%), Positives = 14/25 (56%) Frame = +3 Query: 63 ILPKVSKNLRKWHPKLSSPPLFVML 137 I+P++ + W+P + P+ V + Sbjct: 521 IMPRIQAEVNIWNPLTDTIPIHVWI 545 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 20.6 bits (41), Expect = 6.2 Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +3 Query: 69 PKVSKNLRKWHPKLSSP---PLFVMLRSGATP 155 PKV++ + HP+ + P F + +G TP Sbjct: 173 PKVNETVAATHPRYADPDDCQYFYVCINGDTP 204 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 20.6 bits (41), Expect = 6.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 103 GCHFRKFLETLGSIATKAYDLR 38 G H + E L +I +YDLR Sbjct: 196 GYHVPELCELLDAIHVMSYDLR 217 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,768 Number of Sequences: 336 Number of extensions: 1037 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8963165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -